KEGG   Salinibacterium sp. dk2585: FVA74_10655Help
Entry
FVA74_10655       CDS       T06151                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sald  Salinibacterium sp. dk2585
Pathway
sald00450  Selenocompound metabolism
sald00970  Aminoacyl-tRNA biosynthesis
sald01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sald00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    FVA74_10655
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    FVA74_10655
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sald01007]
    FVA74_10655
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sald03016]
    FVA74_10655
Enzymes [BR:sald01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     FVA74_10655
Amino acid related enzymes [BR:sald01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   FVA74_10655
Transfer RNA biogenesis [BR:sald03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    FVA74_10655
 Prokaryotic type
   Other AARSs
    FVA74_10655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: QEE61977
UniProt: A0A5B9G7D2
Position
complement(2268192..2269763)
Genome map
AA seq 523 aa AA seqDB search
MSSGKSFYIATPIFYVNDVPHIGHAYTEVAADVLARWHRQSGDDTWLLTGTDEHGQKILR
TAVANNVTPREWADRLVETAWKPLLETINISNDDFIRTTDERHENGVRIFLEKLYDDGFI
YQGEFEGHYCVGCEEYKQPSDLVPGTGEFEGQQVCAIHTRPVEVLKETNYFFRMSDFEQP
LLKLYRDNPDFIQPESVRNEIIQFVQQGLRDLSISRSSFDWGVKLPWDDSHVLYVWFDAL
LNYITAIGYGADQENFERRWPAVQLVGKDIARFHAVIWPAMLMAAGLPVSKRVFGHGWLL
VGGEKMSKSKLTGIAPSDITDTFGADAFRYYFMSAINFGQDGSFSWEDLSARYQAELANG
FGNLASRVIAMINRYYDGSVPQPGEYSDADLAIQKTLASAVTKADAAMERLAIHEAIEAI
WKLVDDLNGYITINEPWVLAKNEETRERLGTVLYTTAEGLRALAVLLSPVIPEATAKLWA
ALGFTTPLTEQLITEAGNWGVLQPGATVDTLPPLFPRVEQEQT
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccggcaagtccttctacatcgccacgcccatcttctacgtcaacgacgttccc
cacatcgggcacgcctacacggaggtggcggcggatgtgctcgcccgctggcaccgccag
agcggcgacgacacctggctgttgacgggcaccgacgagcacgggcagaagatcctgcgc
acggccgtcgccaacaacgtgacgccgcgcgagtgggccgaccggctcgtcgagacggca
tggaagccgctgctcgagacgatcaacatctccaacgacgacttcatccgcacgaccgac
gagcggcacgagaatggcgtgcgtatcttcctcgagaagctctacgacgacggcttcatc
taccagggcgaattcgagggtcactactgcgtcgggtgcgaggagtacaagcagccaagc
gacctcgtgccgggcacaggtgagttcgaggggcagcaggtttgcgcgatccacacgcgc
ccggtcgaggtgctcaaggagaccaactacttcttccgcatgagcgacttcgagcagccg
ctgctgaagctctaccgcgacaaccccgacttcatccagccggagagtgtgcgcaacgag
atcatccagttcgtgcagcagggcctgcgcgacctctcgatctcgcgctcgagcttcgac
tggggtgtcaagctgccctgggacgactcgcacgtgctctacgtgtggtttgacgcgctt
ctcaactacatcaccgcgatcggctacggtgccgaccaggagaacttcgaacggcgttgg
ccggccgtgcagctggtcggcaaagacatcgcccgcttccacgccgtcatctggccggcg
atgctcatggcggcgggccttcccgtctcgaagagggtcttcggccacggctggctcctc
gttggcggcgagaagatgtcgaagtcgaagctcacgggcatcgcaccgagcgacatcacc
gacaccttcggtgccgatgcgttccgctactacttcatgagcgcgatcaacttcggccag
gacggttccttctcgtgggaggacctctccgcccgttaccaggccgagctcgccaatggt
ttcggcaacctcgcctcccgcgtgatcgcgatgatcaaccgctactacgacggcagcgtg
ccgcagccgggcgagtactcggatgctgacctcgccatccagaagacgctcgcctcggcc
gtgaccaaggcggatgccgcgatggagcgcttggcgatccacgaggcgatcgaggcgatc
tggaagctggtcgacgatctcaacggctacatcacgatcaacgagccgtgggtgctcgcc
aagaacgaggagacccgcgagcggctcggcaccgtgctctacacgactgccgagggactg
cgcgcgctcgccgtgctgctgtccccagtcatcccggaggcgaccgcgaagctttgggcg
gcactcggcttcacgacgcccctcacggagcagctcatcaccgaggcgggcaactggggc
gtgctgcagccgggcgcgaccgtcgacacgcttccgccgctcttcccgcgcgtcgaacag
gagcagacatga

DBGET integrated database retrieval system