KEGG   Streptomyces alboflavus: SMD44_01788Help
Entry
SMD44_01788       CDS       T05221                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
salf  Streptomyces alboflavus
Pathway
salf00010  Glycolysis / Gluconeogenesis
salf00053  Ascorbate and aldarate metabolism
salf00071  Fatty acid degradation
salf00280  Valine, leucine and isoleucine degradation
salf00310  Lysine degradation
salf00330  Arginine and proline metabolism
salf00340  Histidine metabolism
salf00380  Tryptophan metabolism
salf00410  beta-Alanine metabolism
salf00561  Glycerolipid metabolism
salf00620  Pyruvate metabolism
salf00625  Chloroalkane and chloroalkene degradation
salf00903  Limonene and pinene degradation
salf01100  Metabolic pathways
salf01110  Biosynthesis of secondary metabolites
salf01120  Microbial metabolism in diverse environments
salf01130  Biosynthesis of antibiotics
Module
salf_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:salf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMD44_01788
   00053 Ascorbate and aldarate metabolism
    SMD44_01788
   00620 Pyruvate metabolism
    SMD44_01788
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SMD44_01788
   00561 Glycerolipid metabolism
    SMD44_01788
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SMD44_01788
   00310 Lysine degradation
    SMD44_01788
   00330 Arginine and proline metabolism
    SMD44_01788
   00340 Histidine metabolism
    SMD44_01788
   00380 Tryptophan metabolism
    SMD44_01788
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SMD44_01788
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SMD44_01788
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SMD44_01788
Enzymes [BR:salf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SMD44_01788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ARX82378
UniProt: A0A1Z1W7I2
Position
complement(1911826..1913214)
Genome map
AA seq 462 aa AA seqDB search
MKAHDGMYIGGTWRPAATGDTIPVVNPADEEVIAHVPAGTAADVDAAVRAARAALPAWSA
TPPRERAALIGAIRDGLAARQAEIAETVTAELGAPLRFSEAVHAAVPVLVAGSYADLAAT
YAFEEKVGNSTVYAEPVGVVGAITPWNYPLHQIVAKVAPALAAGCTVVLKPAEDTPLTAR
LFAEIVHGAGLPAGVFNLVTGLGPVAGQALAEHDGVDLVSFTGSTAVGKRIGALAGAAVK
RVALELGGKSANVILPSADLAKAVNVGVANVMANSGQTCSAWTRMLVHTSRYDEAVELAG
AAAAKYGDRIGPVVSEKQRARVRGYIEQGVKEGARLVAGGADAPREQGYYVRPTVFADVT
PEMTIAQEEIFGPVVSILRYEDEADAEAIANGTVYGLAGAVWAGDDAEAVAFARRLHTGQ
VDINGGSFNPLAPFGGYKESGVGRELGAHGLAEYLQTKSLQF
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcccacgacgggatgtacatcgggggcacctggcgccccgccgcgacgggggac
acgatcccggtcgtgaacccggccgacgaagaggtcatcgcccacgtccccgcgggcacc
gccgcggacgtcgacgcggccgtccgcgcggcccgggccgcacttcccgcctggtcggcc
acgccgccccgggagcgcgcggcgctgatcggcgcgatccgcgacggcctggccgcgcgc
caggccgagatcgcggagacggtcaccgccgagctgggcgccccgctccgcttctcggag
gccgtgcacgccgccgtccccgtcctggtcgccggttcctacgcggacctcgcggccacg
tacgccttcgaggagaaggtcggcaactccacggtgtacgccgagcccgtcggcgtggtc
ggcgccatcacgccctggaactacccgctgcaccagatcgtcgcgaaggtcgcccccgcc
ctcgccgcgggctgcacggtggtgctcaagcccgccgaggacaccccgctgacggcccgc
ctcttcgcggagatcgtgcacggagcgggcctgcccgcgggcgtgttcaacctggtcacc
ggcctcggcccggtcgcgggccaggcgctcgccgagcacgacggcgtcgacctggtgtcg
ttcaccgggtccacggccgtcggcaagcgcatcggcgccctcgcgggcgccgccgtcaag
cgcgtcgccctcgaactcggcggcaagtccgccaacgtcatcctgccgagcgccgacctc
gcgaaggccgtgaacgtcggcgtcgccaacgtcatggccaactccggccagacgtgcagc
gcctggacccgcatgctggtgcacacctcccggtacgacgaggcggtggagctcgccggg
gccgccgccgcgaagtacggcgaccgcatcggcccggtcgtcagcgagaagcagcgcgcc
cgtgtgcgcggctacatcgagcagggcgtcaaggagggcgcccgcctggtcgcgggcggc
gccgacgccccgcgcgagcagggctactacgtacgcccgacggtcttcgccgacgtcacg
ccggagatgacgatcgcccaggaggagatcttcggacccgtcgtctcgatcctgcggtac
gaggacgaggcggacgccgaggccatcgccaacggcaccgtgtacgggctcgcgggcgcg
gtgtgggccggtgacgacgccgaggccgtggccttcgcccgccgcctgcacaccgggcag
gtcgacatcaacggcggcagcttcaacccgctggccccgttcggcggttacaaggagtcg
ggcgtcggccgcgaactcggcgcccacggcctcgccgagtacctccagaccaagtcgctc
cagttctga

DBGET integrated database retrieval system