KEGG   Streptomyces alboflavus: SMD44_01989Help
Entry
SMD44_01989       CDS       T05221                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
salf  Streptomyces alboflavus
Brite
KEGG Orthology (KO) [BR:salf00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    SMD44_01989
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF2070
Motif
Other DBs
NCBI-ProteinID: ARX82576
UniProt: A0A1Z1W852
Position
2141857..2143131
Genome map
AA seq 424 aa AA seqDB search
MEHITLLLGIVIVTALVFDFTNGFHDTANAMATTISTGALKPKTAVAMSAVLNLVGAFLS
VEVAKTISGGIINEDGLKTEVIFAALVGAILWNLLTWLLGLPSSSSHALFGGLIGAAVMS
MGWSSVNGGTVVTKVLLPAVAAPLVAGIAATLATRLTYRISSRTDEKATSKGYRAGQIAS
AGLVSLAHGTNDAQKTMGIITLALITGGVLNPGANPPMWVIVSAGVAIALGTYLGGWRII
RTMGKGLTELAPPQGFAAQTSAATAILASSHIGFSLSTTQVCSGAVMGAGLGRKGGVVRW
STATRMFVAWGLTLPAAGLVGAGAELLTKQGTWGIATTAALLVGGSALIWSLSRRQPVDH
TNVTADEIGTPGVGTAEPAGVVTTAIAAVTPPPAGPVTTGTGTSAVEGAAPAPSVADSAR
PATV
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggaacacatcacgcttctcctcgggatcgtgatcgttaccgctctcgtgttcgatttc
acgaacggtttccacgacacagccaacgcgatggcgacgaccatctcgaccggcgctctc
aagcccaagacggcggtggccatgtccgccgtgctgaacctcgtcggagcgttcctctcc
gtcgaagtcgccaagaccatctccggcggcatcatcaatgaagacggtctcaagaccgaa
gtgatcttcgcggccctggtgggcgcgatcctctggaacctgttgacctggctgctcggc
ctgccgtccagctcctcccacgccctgttcggcggcctcatcggcgccgccgtgatgtcg
atgggctggtcctcggtcaacggcggcacggtcgtcaccaaggtgctgctccccgcggtc
gccgccccgctcgtcgccggcatcgcggcgacgctcgccacccggctcacgtacaggatc
agcagccgtacggacgagaaggcgacctcgaagggctaccgcgccgggcagatcgcctcg
gccgggctcgtctcgctcgcccacggcacgaacgacgcccagaagacgatgggcatcatc
acgctggccctgatcaccggcggcgtgctgaacccgggcgccaaccccccgatgtgggtc
atcgtctcggccggtgtcgccatcgcgctcggcacgtacctgggcggctggcgcatcatc
cgcaccatgggcaagggcctcaccgagctggcgccgccgcagggcttcgcggcgcagacg
tccgccgcgacggcgatcctcgcctcctcgcacatcggcttctccctctccaccacccag
gtctgctccggcgccgtgatgggcgcgggcctcggccgcaagggcggcgtggtccgctgg
tccacggcgacgcggatgttcgtggcgtggggcctgacgctcccggccgccggtctggtc
ggcgcgggcgccgagctcctcaccaagcagggcacctggggcatcgccaccacggccgcg
ctcctggtcggcggctccgccctcatctggtcgctttcgcgccgccagccggtcgaccac
acgaacgtcacggccgacgagatcggcacccccggcgtcggcaccgccgaacccgcgggc
gtcgtgaccaccgccatcgccgccgtcaccccgcccccggcgggcccggtgaccaccggc
accgggacctccgcggtcgaaggcgccgcgcccgccccgtccgtggcggactccgcccgg
cccgccacagtgtaa

DBGET integrated database retrieval system