KEGG   Shewanella algae: BS332_19425Help
Entry
BS332_19425       CDS       T05622                                 

Gene name
metG
Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
salg  Shewanella algae
Pathway
salg00450  Selenocompound metabolism
salg00970  Aminoacyl-tRNA biosynthesis
salg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:salg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BS332_19425 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BS332_19425 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:salg01007]
    BS332_19425 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:salg03016]
    BS332_19425 (metG)
Enzymes [BR:salg01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BS332_19425 (metG)
Amino acid related enzymes [BR:salg01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BS332_19425 (metG)
Transfer RNA biogenesis [BR:salg03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BS332_19425 (metG)
 Prokaryotic type
   Other AARSs
    BS332_19425 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1e tRNA-synt_1 tRNA-synt_1f Torus PhnA_Zn_Ribbon
Motif
Other DBs
NCBI-ProteinID: AXQ16080
Position
4297779..4299809
Genome map
AA seq 676 aa AA seqDB search
MATTQRKILVTSALPYANGPIHLGHMLEYIQTDIWSRFQKLRGHECHYICADDAHGTPIM
LKAQQMGIQPEEMIAKVNQEHQQDFAEFNIAFDNYHSTHSEENRQLASEIYLKLRDNGYI
KSKTISQLFDPEKSMFLPDRFVKGTCPKCKSEDQYGDNCDACGATYSPTELINPRSAVSG
ATPVMKETEHFFFDLPAFETMLKEWTHSGSLQSEMANKLDEWFEQGLQQWDITRDAPYFG
FEIPDAPGKYFYVWLDAPVGYMGSFKNLCDKRPELNFDEFWNVDSKAEVYHFIGKDIVYF
HSLFWPAMLKGAGYRQPSSVYAHGYVTVNGAKMSKSKGTFIKARTYLDHLDPEYLRYYYA
AKLSSRIDDLDLNLEDFAARVNSDLVGKLVNLASRTAGFIVKRFDAKLAKVEDNCLAESF
LAKQELIAELYEGREYGKAMREIMALADVANAYVADEAPWQLVKNEETLARAHQVCSVAL
NLFRILVTYLKPVLPRLAADVEAFLKLELSWSGLALDMAGHQINPFKPMMQRIELDKVNA
MVEASKESLKATEDTPKASGPLADDPISPTIEFDDFAKLDLRIALIKKAEHVPEANKLLK
LQLDLGGETRQVFAGIKSAYAPEDLEGKLTVMVANLAPRKMRFGLSEGMVLAAGPGGKDL
WVLEPHEGAQPGMRVK
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atggcaactacacaacgtaaaatccttgttaccagcgcgcttccatatgccaacggtccc
attcacctgggccacatgctcgagtacatacagacagatatctggtcccgcttccaaaaa
ctccgtggccatgagtgccattatatctgtgccgatgatgcccacggtacacctatcatg
ctcaaggctcagcagatggggatccaacccgaagagatgatcgccaaggtcaatcaagag
catcagcaggattttgccgagttcaatattgcctttgacaattatcacagcacccacagc
gaagagaaccgtcagctggccagtgagatctacctcaaactgcgcgacaacggttatatc
aagagcaagacgatttcccagctgttcgatccggaaaagtccatgttcctgccggataga
ttcgtcaagggcacctgccccaagtgtaagtctgaagaccaatacggcgacaactgcgac
gcctgtggcgccacctacagcccaaccgagctgatcaatccgcgctcggcggtatccggt
gccactccggtcatgaaagagacagagcacttcttcttcgatctgcccgcctttgaaacc
atgctcaaagagtggacccattcaggttcactgcagagtgaaatggccaacaaactggat
gaatggttcgagcaaggcctgcagcagtgggatatcacccgtgatgccccctactttggc
tttgaaatccccgatgcgccgggcaaatacttctatgtttggctcgatgcacctgtgggc
tacatgggttcattcaagaacctctgcgacaagcgcccggagctgaactttgacgagttc
tggaatgtcgactcaaaggccgaggtgtatcacttcatcggcaaagacattgtctatttc
cacagcctattttggccggccatgctcaaaggcgccggctaccgtcagccaagcagtgtc
tatgcccacggctatgtcactgtcaacggcgccaagatgtccaagtccaagggcaccttt
atcaaggcccgtacttacctggatcatctggatcccgagtatctacgctactactacgcc
gccaagctctccagccgcattgacgatctggacctgaacctggaagactttgccgccaga
gtcaactcggacctggtcggtaagctggttaacctggcgagccgtaccgccggctttatc
gtcaagcgttttgacgccaaactggctaaagtagaagacaactgcctggccgagtccttc
ctggccaaacaggaactgatcgccgagctgtatgaaggccgcgaatacggcaaggcgatg
cgtgaaatcatggcgctggccgatgtcgccaacgcttacgttgccgatgaagctccttgg
cagttggtgaaaaacgaagaaaccttggcccgcgcccaccaggtatgctcagtggcgctg
aatttgttccgtattctggtgacttatctcaagccggtactgccacgcctggccgccgat
gttgaggccttcctcaagctggagctcagctggagcggcttggcactggatatggccggt
caccaaatcaacccgttcaagcctatgatgcaacgcattgagctcgataaggtgaatgcc
atggtggaagcctccaaggaaagcctcaaggcaaccgaggatacgcccaaggccagcggc
ccattggcggatgaccctatcagcccaaccatagagtttgacgactttgccaagctggat
ctgcggattgcacttatcaagaaggccgagcatgtccctgaagccaacaagctgctgaag
ttacagctggatctcggcggcgaaacccgtcaggtatttgccggtattaagtcggcttat
gccccggaagatctcgaaggcaaactgacagtaatggtggccaaccttgctcctcgcaag
atgcgctttggcttgtctgaaggtatggtgctggccgcaggcccgggtggcaaggatctc
tgggttctcgagccccatgaaggcgctcaacctggcatgagagtcaaataa

DBGET integrated database retrieval system