KEGG   Saliniradius amylolyticus: HMF8227_01585Help
Entry
HMF8227_01585     CDS       T05447                                 

Gene name
lhgO
Definition
(GenBank) L-2-hydroxyglutarate dehydrogenase, mitochondrial
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
salh  Saliniradius amylolyticus
Pathway
salh00310  Lysine degradation
salh01100  Metabolic pathways
salh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:salh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    HMF8227_01585 (lhgO)
Enzymes [BR:salh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     HMF8227_01585 (lhgO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Pyr_redox_2 FAD_binding_2 Mqo NAD_binding_8 Pyr_redox Pyr_redox_3 Trp_halogenase FAD_binding_3 GMC_oxred_N NAD_binding_9 Lycopene_cycl TrkA_N
Motif
Other DBs
NCBI-ProteinID: AWL12059
UniProt: A0A2S2E384
Position
complement(1678837..1680048)
Genome map
AA seq 403 aa AA seqDB search
MKRSYDLTIIGGGIIGTALAWRLSQRYPRKRVVLLEKESEVALHQTGRNSGVIHAGVYYP
PDSLKARYCRQGLKEVIAFCRQQQIPYAQPGKLIVATSEQEVQRLEKLWFRCQDNGLQPQ
WVDAYELHRMEANISGKAAIRVKDTGIVDYARVARRMLELAQKNGVEVRFSAQVQGLDEG
SQGVTVKTNEEVIQTERLVNCAGLMTDRLARMMGLEPDFQIIPFRGEYFRLPKRLNQICR
HLIYPVPDPSLPFLGVHLTRMIDGSVTVGPNAVLAAGREAYQWRRFSGTDCMQMATFGGF
WRLMGRYWQSGLEEMKNSLWTSGYLQQVRKYCPQIQRRDLQPYPSGIRAQAVNAKGEMLH
DFHFLQTERSLHVGNAPSPAATSSIPIADALIQKLVGDGEQHF
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcggtcttatgacctgactattatcggcggcggtatcataggtacggctctggcc
tggcgtctgagtcagcgttacccccgaaaacgtgtagtattgttggagaaagaatctgag
gtggcgctgcatcagaccgggcgtaactccggtgttattcatgccggagtctattatccg
cctgacagcttaaaggcacggtattgtcgtcaggggctgaaggaagttatcgcgttttgt
cgtcagcaacagattccttacgctcagcccggtaaattgatcgtcgccaccagcgagcaa
gaagttcagcgccttgaaaagctgtggtttcgttgtcaggacaatggcttgcagccgcag
tgggtggacgcctatgaacttcaccgaatggaagcgaacattagcggaaaagccgcgata
agagtcaaagataccggtattgtggattacgcccgtgtcgcccggcgaatgctggaactg
gcgcagaaaaacggtgttgaggtccgtttttccgctcaggtgcagggactggatgaagga
agccagggtgtcactgtaaaaacgaatgaagaggtcatccagacggaacggctggtgaat
tgtgccggactgatgaccgaccgcctggcgcgtatgatggggctcgaaccggattttcag
ataattccttttcgcggagaatactttcggttgccgaagcgtctgaaccagatctgtcgg
cacctgatctatccggtgccggatccctcactgcctttccttggggtacatctgacccga
atgatcgacggttcggtcacggtggggcctaatgcggtattggccgccggacgagaagct
taccagtggcggcgatttagcggcacggattgcatgcaaatggccacgtttggaggcttt
tggcgtttgatggggcgttactggcaaagtggtcttgaagagatgaaaaactcgctttgg
acatcaggctatttacaacaagtccgtaaatactgcccgcaaattcaacggcgggacttg
caaccataccccagcggtatccgggctcaggcagtcaatgctaaaggcgagatgctgcat
gattttcactttttgcagacggagcgcagcctgcatgttggtaacgcgccgtcaccggca
gccacctcgtccattcctattgccgatgcactgatccaaaagcttgttggtgacggggag
caacatttctaa

DBGET integrated database retrieval system