KEGG   Saliniradius amylolyticus: HMF8227_02570Help
Entry
HMF8227_02570     CDS       T05447                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
salh  Saliniradius amylolyticus
Pathway
salh03010  Ribosome
Brite
KEGG Orthology (KO) [BR:salh00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    HMF8227_02570
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:salh03011]
    HMF8227_02570
Ribosome [BR:salh03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    HMF8227_02570
  Bacteria
    HMF8227_02570
  Archaea
    HMF8227_02570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AWL13022
UniProt: A0A2S2E665
Position
complement(2720592..2720924)
Genome map
AA seq 110 aa AA seqDB search
MEALAKHRFARTSAQKARLVADQIRGMHVEKALELLTYSPKKSAELIKKVLESAIANAEH
NEGADIDELTVAKIFVDEGPTMKRIKPRAKGRADRIFKRSSHITVVVADN
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaagcattagctaaacaccgttttgcccgcacctcggctcaaaaagcacgcttggta
gcggaccaaattcgcggaatgcacgttgagaaagcgcttgagcttctgacttacagcccg
aaaaaatcagctgagctgatcaaaaaggtgctggagtccgccattgccaacgctgagcac
aacgagggcgcagatatcgatgagctgaccgtagctaagatcttcgttgacgaaggtcct
accatgaagcgcattaagccccgtgccaaaggtcgtgcggatcgtattttcaagcgtagc
agtcacatcactgtggttgtggctgataactag

DBGET integrated database retrieval system