KEGG   Salinarchaeum sp. Harcht-Bsk1: L593_00670Help
Entry
L593_00670        CDS       T02693                                 

Definition
(GenBank) theronine dehydrogenase-like Zn-dependent dehydrogenase
  KO
K22969  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
sali  Salinarchaeum sp. Harcht-Bsk1
Pathway
sali00030  Pentose phosphate pathway
sali01100  Metabolic pathways
sali01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sali00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    L593_00670
Enzymes [BR:sali01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     L593_00670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu_dehyd_C ADH_N ADH_zinc_N ADH_N_2
Motif
Other DBs
NCBI-ProteinID: AGN00089
UniProt: R4W7U6
Position
complement(135240..136328)
Genome map
AA seq 362 aa AA seqDB search
MRAIAVGRGETDPTVVEIDEPEPAEGEALIRTLRVGIDGTDHEVIGSNHGGYPEGEDFQV
LGHEAIGVVEDPNGTDLEAGQLVVPTVRRPPGGDAFGSGAEPNEYFERNEPDMAPAGEYV
ERGIAGAHGYMAEYFTSEPRYLVPVPDEFAEIGFLVEPISNSEKAFDLAEASRSTFEWDP
ESAIVLGNGPLGLLTLAMLDDRGFDRHYCLGRRDRPDPTIDIIEELGATYVDSRETPVDE
LPGAEEPMDFVYEATGYAPHAFQTIDALAPNGVGVLLGIPGEWEFEIDGGALHRDFVLEN
KALLGSVNSHVPHFEAAVETLAGMPEWFTDAIVTHVFDPEDVDEAFETGDDRIKVVVEFD
DL
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgatcgcggtcggacgcggcgagacggatccgacggtcgtcgaaatcgacgag
cccgaacctgccgagggagaggcgctgatccggaccctccgggtcggcatcgacggcacc
gatcacgaggtcatcgggagcaaccacggcggctaccccgagggcgaggacttccaggtg
ctcggccacgaggcgatcggcgtcgtcgaggacccgaacggcaccgacctcgaggcgggc
cagctcgtcgttccgacggtccgacgaccgccgggcggtgacgccttcggttcgggtgct
gagccgaacgagtacttcgagcgaaacgagcccgacatggcgcccgctggcgagtacgtc
gagcgcggcatcgcgggtgcccacggctatatggcggagtacttcacgagcgagccacgc
tacctcgttccggttcccgacgagtttgctgagatcggattcctcgtggagccgatcagc
aactccgagaaggccttcgacctcgcggaggcgtcccgctcgacgttcgagtgggacccc
gagtcggcgatcgtcctcgggaacggcccgctcggcctgctcacgctcgcgatgctcgac
gatcgtggcttcgaccgccactactgtctcggtcgccgggatcgccccgatccaacgatc
gatatcatcgaggaactcggcgcgacctacgtcgactctcgcgaaacgcccgtcgacgaa
ctccccggggccgaggagccgatggacttcgtctacgaggcgacggggtacgccccacat
gcgttccagacgatcgacgccctcgcgcccaacggcgtcggcgtcctgctcgggatcccc
ggcgagtgggagttcgagatcgacggcggcgcgctgcatcgcgacttcgtgctggagaac
aaggcgctgctcgggagcgtgaactcccacgtaccccacttcgaggcggccgtcgagacg
ctcgcaggcatgcccgagtggttcacggacgcgatcgtgacccacgtcttcgatcccgag
gacgtcgacgaggcgttcgagaccggcgacgatcgcatcaaggtcgtcgtggagttcgac
gacctgtag

DBGET integrated database retrieval system