KEGG   Salinarchaeum sp. Harcht-Bsk1: L593_01650Help
Entry
L593_01650        CDS       T02693                                 

Definition
(GenBank) flavin-dependent dehydrogenase
  KO
K17830  digeranylgeranylglycerophospholipid reductase [EC:1.3.1.101 1.3.7.11]
Organism
sali  Salinarchaeum sp. Harcht-Bsk1
Pathway
sali00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sali00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    L593_01650
Enzymes [BR:sali01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.101  2,3-bis-O-geranylgeranyl-sn-glycerol 1-phosphate reductase [NAD(P)H]
     L593_01650
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.11  2,3-bis-O-geranylgeranyl-sn-glycero-phospholipid reductase
     L593_01650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Trp_halogenase Lycopene_cycl FAD_binding_2 Pyr_redox_2 FAD_oxidored FAD_binding_3 Thi4 HI0933_like GIDA NAD_binding_8 Pyr_redox_3 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AGN00283
UniProt: R4W6B8
Position
complement(334525..335754)
Genome map
AA seq 409 aa AA seqDB search
MDDHYDVVIAGAGPAGAQCARDVAARGYDVVVLETEAEDEFPAQSNKSTGGTFPSMMAAF
GIPDDVVMQFTDEVVLESPNDFYVQDQPGAVLEFADFKRFLVADSQEKGADYIWDARVTA
PLTEGGELVGVTYNGDEEVRGEVIVDATGPSAPLAKKLGVSNLERRNQAIGIEYEFEGVN
LDADGHADLADAMMLRLDHDLAPGGYSWIFHTGDDTAKVGLCYIQNESYQRYATADRTID
GYLDYWVGKDPRLQDATRLEGKQHRGSAHIQPPTSLSTDSFMAIGDTVPTIDPLWGEGIH
KCMKSARSAAIVADHALTGEVNTSAEKLSIYDKLWHQDVAPNVNKRLLMTKLLYLAPNGR
YDQLMNDLRSAAKNTLAEANEGNKRAIASLLHLRDVPTLARLAKLHYSG
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggacgaccactacgacgtggtgatcgccggcgcgggcccggctggcgcgcagtgcgct
cgggacgtggccgcgcggggatacgacgtggtggtcctcgagacggaagccgaggacgag
ttccccgcacagtcgaacaagtccaccgggggcaccttcccctcgatgatggcagccttc
gggatccccgacgacgtcgtgatgcagttcaccgacgaggtagtgctagaatctccgaac
gacttctacgtgcaggaccaaccgggtgccgtcctcgagttcgccgacttcaaacgattc
ctcgtggccgacagccaggagaagggggccgactacatctgggacgcgcgggtgacggcg
ccactcacggagggcggcgaactggtcggcgtcacctacaacggcgacgaggaagttcgc
ggcgaggtgatcgtcgacgcgacggggccgagcgcgccgctcgccaagaagttgggcgtc
agcaacctcgagcgacggaaccaggcaatcgggatcgagtacgagttcgaaggcgtgaat
ctcgacgccgacggccacgccgacctcgccgacgcgatgatgctccgcctcgaccacgac
ctcgcgccgggtgggtactcctggatcttccacacgggcgacgacacggcgaaggtcggc
ctgtgctacatccagaacgagagctaccagcgttacgccaccgccgaccggacgatcgac
ggctacctcgactactgggtcgggaaagatccccggctccaggacgccacccgactcgag
ggcaagcaacaccgtggatcggctcacatccagcccccgacgtcgctgtcgacggactcg
ttcatggcgatcggcgacaccgttccgacgatcgatccgctctggggagagggcatccac
aagtgcatgaagtccgctcgctcggcggcgatcgtcgcagaccacgcgctgaccggcgag
gtgaacacctccgcggagaagctgtcgatctacgacaagctctggcaccaggacgtcgcc
ccgaacgtcaacaagcggctcctgatgacgaagctgctctacctcgctccgaacggtcgc
tacgatcagctcatgaacgacctccggagcgctgcgaagaacaccctcgccgaggcgaac
gaggggaacaagcgcgcgatcgcgagcctgctccatctccgggacgttccgacgctcgcc
cgactggcgaaactccactactccggctag

DBGET integrated database retrieval system