KEGG   Salinarchaeum sp. Harcht-Bsk1: L593_05095Help
Entry
L593_05095        CDS       T02693                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
sali  Salinarchaeum sp. Harcht-Bsk1
Brite
KEGG Orthology (KO) [BR:sali00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    L593_05095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 SpoVS
Motif
Other DBs
NCBI-ProteinID: AGN00968
UniProt: R4W7H3
Position
complement(1075146..1076324)
Genome map
AA seq 392 aa AA seqDB search
MVGILLVVGVVVAMFVAYNIGGSTTGPAFGPAVGADAISKTTAAALMGVFFFIGAWTLGR
NVVTKLGSELVVDPGVFTLETSIAVLFFIGVALLMGNLFGVPASTSMTAVGAIAGLALAG
GVLDVAVMGEILTWWIVSPVIGFWVSLIIGRYFYARLNRMVAIERSSGPLIEVDRSGAVP
LPKLHRTTNRRELIGTVTVVAIGCLMAFSSGTSNIANAVAPLVGSGEVAMNPAIIVGGIA
VTIGAFTIARRTLETMGSDITELPLTAAIVVASVSSTLVIFLSALGIPASFVIIATMSIV
GLGWGRATRPVTVPEAVSGGESPPVTVDALAADEAGEELPPIGEEDVEDIPSPGSLFNPA
TTARVVLMQNIVPAIATVGSYLTFRFVPLFGL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggtcgggatcctcctcgtcgtcggcgtcgtcgtcgccatgttcgtcgcgtacaacatc
ggcggctcgacgaccggcccggcgttcgggccggccgtcggcgccgacgcgatatcgaaa
acgacggctgcagcgctgatgggcgtcttcttcttcatcggcgcctggacgctcggccgg
aacgtcgtgacgaagctcggctcggaactcgtcgtcgatcccggggtcttcacgctcgaa
acgtcgatcgcggtgctgtttttcatcggcgtcgcgctcctcatgggcaaccttttcggc
gtcccggcctcgacgtcgatgactgccgtcggggcgatcgcagggctggcactggccggt
ggcgtcctggacgtcgccgtcatgggcgagatcctcacgtggtggatcgtctcgccggtc
atcggcttctgggtatcgttgatcatcggccggtacttctacgcacgactcaaccgcatg
gtggcaatcgaacgaagttcgggcccgctcatcgaggtcgatcgctccggcgccgttccg
ctcccgaagctccaccggacgacgaaccgtcgcgaactgatcgggacggtgacggtcgtc
gcgatcggctgcctgatggccttcagctccggtacgtccaacatcgccaacgccgtcgcg
ccgctggtcggcagcggtgaagtggcgatgaatccggcgataatcgtcgggggcatcgcc
gtcacgatcggcgcgttcacgatcgccaggcggaccctggagacgatgggaagcgacatt
acggaactcccgttgacggctgcaatcgtcgtcgcctccgttagttcgacgctcgtgatc
ttcctctcggcgctgggcattcccgcgagtttcgtcatcatcgcgacgatgtcgatcgtc
gggctcggctggggacgtgcgacccgaccggtgaccgtccccgaagccgtttcgggcggg
gaatccccaccggtgactgtcgacgcgttggccgccgacgaagcgggcgaagagttgccc
ccgatcggcgaggaggacgtcgaggacatccccagtccggggagcctgttcaacccggcg
acgacggctcgggtcgtcctgatgcagaatatcgtgccggcgatcgcgacggttgggtcg
tatctcaccttccggttcgtgccgctgttcgggctgtaa

DBGET integrated database retrieval system