KEGG   Streptomyces albireticuli: SMD11_2969Help
Entry
SMD11_2969        CDS       T05230                                 

Definition
(GenBank) putative low-affinity inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
salj  Streptomyces albireticuli
Brite
KEGG Orthology (KO) [BR:salj00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    SMD11_2969
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Myc_target_1
Motif
Other DBs
NCBI-ProteinID: ARZ68616
UniProt: A0A1Z2L2W9
Position
complement(3442772..3443749)
Genome map
AA seq 325 aa AA seqDB search
MTIAVALGFTYTNGFHDSANAIATSVSTRALTPRAALAMAAVMNLAGAFLGSGVAKTVSK
GLIETPVGDKGMGILFAALIGAIAWNMITWYFGLPSSSSHALFGGMVGAALAGGTTVIWS
GVVEKVVIPMFLSPFVGLIIGYLVMVVIMWMFRKANPHKAKRGFRIAQTVSAAGMALGHG
LQDAQKTMGIVVMALVIGDVQSMDDAIPLWVKLSCAITLSLGTYAGGWRIMRTLGRRIIE
LDPPQGFAAETTAASVMYTASFMFHAPISTTHVITSAIMGVGSTKGSRAVRWGVAKNIVM
GWFITMPAAAVVAAFSYWIVNLAFG
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatcgcggtcgcgctcggattcacatatacgaacggtttccacgattccgcgaac
gccatcgcgacctcggtctccacgcgggcgctgaccccgcgcgcggccctcgcgatggcg
gcggtgatgaacctcgcgggtgccttcctcggcagcggggtcgccaagaccgtcagcaag
ggcctgatcgagacgccggtgggcgacaaggggatgggcatcctcttcgccgcgctgatc
ggcgcgatcgcctggaacatgatcacctggtacttcggccttccgtcgtcctcctcgcac
gccctgttcggcggcatggtgggcgcggcgctcgcgggcggtacgaccgtcatctggtcg
ggcgtcgtcgagaaggtcgtcatcccgatgttcctctcgccgttcgtcggcctgatcatc
ggctatctggtgatggtcgtgatcatgtggatgttccggaaggccaacccgcacaaggcg
aagcgcggcttccggatcgcccagaccgtctccgcggcgggcatggcgctcggccacggt
ctccaggacgcgcagaagaccatgggcatcgtggtgatggccctggtcatcggtgatgtg
cagtccatggacgacgcgatcccgctctgggtcaagctgtcctgcgcgatcacgctctcg
ctcggtacgtacgcgggtggctggcggatcatgcggacgctcggccgccggatcatcgag
ctggacccgccgcagggcttcgcggccgagacgaccgccgcctcggtgatgtacacggcg
tcgttcatgttccacgcgccgatctcgaccacgcacgtcatcacgtccgcgatcatgggc
gtgggctccacgaagggttcgcgcgccgtccgctggggcgtcgccaagaacatcgtgatg
ggctggttcatcaccatgccggccgcggccgtcgtcgccgcgttcagctattggatcgtg
aatctcgcgttcggctag

DBGET integrated database retrieval system