KEGG   Streptomyces albireticuli: SMD11_3526Help
Entry
SMD11_3526        CDS       T05230                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
salj  Streptomyces albireticuli
Pathway
salj00450  Selenocompound metabolism
salj00970  Aminoacyl-tRNA biosynthesis
salj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:salj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SMD11_3526
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SMD11_3526
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:salj01007]
    SMD11_3526
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:salj03016]
    SMD11_3526
Enzymes [BR:salj01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SMD11_3526
Amino acid related enzymes [BR:salj01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SMD11_3526
Transfer RNA biogenesis [BR:salj03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SMD11_3526
 Prokaryotic type
   Other AARSs
    SMD11_3526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g Anticodon_1 tRNA-synt_1 HHH_8 GSHPx
Motif
Other DBs
NCBI-ProteinID: ARZ69159
UniProt: A0A1Z2L4E0
Position
complement(4028826..4030544)
Genome map
AA seq 572 aa AA seqDB search
MARHLITSALPYINGIKHLGNMVGSMLPADVYARYLRQTGRETLYICATDEHGTPAELGA
KELGLPVAEFCAKQHDAQKAIYDGFALSFDYFGRSSSPENREITQHFARRLQENGFIEER
SIRQVYSLADGRFLPDRYIVGTCPHCGYDKARGDQCENCTRVLDPTDLIDARSAISGSSE
LEVRETTHLFLLQSKLQGEVEAWIDEHGKDWPVLASSIARKWLTEGLNDRAITRDLDWGV
PVPADTWPELAAEGKVFYVWFDAPVEYIGATKEWAAQDPENRDWKSWWYEATDVRYTQFM
GKDNVPFHTVMFPATQLGTREPWKKVDYVKAFNWLNYYGGKFSTSQKRGVFTHDALELLP
ADYWRYFMMANAPESDDTSFTWELFSATVNKDLADVLGNFVNRVLSFSKKRFGEQVPAGA
EAGEAEAALGREIAQLLQEYEEHMEAMQFRKAAQALRALWSAGNSYLEAKAPWLEIKTDP
DAAALTLRTAMNLIHLYAVISEPFIPQSASALRLAFDLADDTRTWVTADEARSLSFVPAG
TPFSVPPVLFAKITEEDLESYRERFGGGDEAA
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggctcgacacctcatcaccagcgcccttccgtacatcaacgggatcaagcacctgggc
aacatggtggggtccatgctcccggcggacgtgtacgccaggtacctccgccagaccggc
cgcgagacgctctacatctgcgccaccgacgagcacggcaccccggccgagctgggcgcc
aaggagctcggcctgcccgtggccgagttctgcgccaagcagcacgacgcccagaaggcg
atctacgacggcttcgccctctccttcgactacttcggccgcagctcctcgccggagaac
cgggagatcacccagcacttcgcccgccggctccaggagaacgggttcatcgaggagcgc
tcgatccgccaggtctactccctggccgacggccgcttcctgcccgaccgctacatcgtc
ggcacctgcccgcactgcggctacgacaaggcccgcggcgaccagtgcgagaactgcacc
cgcgtcctcgaccccacggacctgatcgacgcccgctcggcgatcagcggcagcagcgag
ctggaggtccgcgagaccacgcacctcttcctcctccagtcgaagctccagggcgaggtc
gaggcctggatcgacgagcacggcaaggactggcccgtcctggcctcctcgatcgcccgc
aagtggctgaccgagggcctgaacgaccgcgcgatcacccgtgacctggactggggcgtc
cccgtcccggccgacacctggccggagctggccgccgagggcaaggtcttctacgtctgg
ttcgacgccccggtcgagtacatcggcgcgacgaaggagtgggcggcccaggacccggag
aaccgcgactggaagtcctggtggtacgaggcgacggacgtccgctacacccagttcatg
ggcaaggacaacgtcccgttccacacggtgatgttccccgccacccagctcggcacccgc
gagccctggaagaaggtcgactacgtcaaggccttcaactggctgaactactacggcggc
aagttctccacctcccagaagcgcggcgtcttcacgcacgacgccctggagctgctgccc
gccgactactggcgctacttcatgatggccaacgcccccgagtcggacgacacctcgttc
acctgggagctgttctcggccaccgtgaacaaggacctcgccgacgtcctgggcaacttc
gtcaaccgcgtcctgtccttctcgaagaagcgcttcggcgagcaggtcccggccggcgcc
gaggcgggcgaggccgaggccgccctgggccgcgagatcgcccagctgctccaggagtac
gaggagcacatggaggccatgcagttccgcaaggcggcgcaggccctgcgcgccctgtgg
agcgcgggcaactcctacctggaggccaaggccccctggctggagatcaagaccgacccg
gacgccgcggccctcacgctgcgcacggcgatgaacctgatccacctgtacgcggtgatc
tcggagccgttcatcccgcagtcggcgtcggccctgcgcctggcgttcgacctcgccgac
gacacccggacgtgggtcacggcggacgaggcccgctcgctgtccttcgtcccggccggt
acgccgttcagcgtccccccggtgctcttcgcgaagatcaccgaggaggacctggagtcc
taccgcgagcgcttcggcggcggcgacgaggccgcgtga

DBGET integrated database retrieval system