KEGG   Streptomyces albireticuli: SMD11_5433Help
Entry
SMD11_5433        CDS       T05230                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
salj  Streptomyces albireticuli
Pathway
salj00020  Citrate cycle (TCA cycle)
salj00480  Glutathione metabolism
salj01100  Metabolic pathways
salj01110  Biosynthesis of secondary metabolites
salj01120  Microbial metabolism in diverse environments
salj01130  Biosynthesis of antibiotics
salj01200  Carbon metabolism
salj01210  2-Oxocarboxylic acid metabolism
salj01230  Biosynthesis of amino acids
Module
salj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
salj_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:salj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SMD11_5433
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SMD11_5433
Enzymes [BR:salj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     SMD11_5433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ARZ71021
UniProt: A0A1Z2L9X3
Position
complement(6175391..6177613)
Genome map
AA seq 740 aa AA seqDB search
MTDSTIIYTHTDEAPALATHSFLPVIQAYARAAGVTVETRDISLAGRIIAGFPEFLEESQ
RIEDALAELGELAKTPGANIIKLPNISASIPQLKAAVAELQAQGYALPDYPDDPKTEQDK
DVRARYDKVKGSAVNPVLREGNSDRRAPASVKNYAKTHPHRMGAWSSDSKTNVATMGADD
FRSTEKSAVIAEAGTLRIELAAEDGTTTVLRESVPVLAGEVVDASVMRVAALREFLTAQI
ARAKAEGVLFSVHLKATMMKVSDPIVFGHVVRAFFPKTFAKYGEALVAAGLSPNDGLGTI
LKGLESVPHLGTEISASFEAELAEGPALAMVDSDKGITNLHVPSDVIVDASMPAMIRTSG
HMWGPDGQEADTLAVLPDSSYAGVYQAVIEDCRAHGAFDPSTMGSVPNVGLMAQKAEEYG
SHDKTFEIAAAGTVRVVDAAGAVVLEQAVNAGDIFRMCQAKDAPIRDWVKLAVTRARAAG
APAVFWLDENRAHDARLIEKVKAYLPEHDTEGLRIEIMSPVEATKFSLERIRRGEDTISV
TGNVLRDYLTDLFPILELGTSAKMLSVVPLMNGGGLFETGAGGSAPKHVQQLVKENYLRW
DSLGEFFALAASFEHLAQTTGNARAQVLADTLDRATATFLNEDKSPSRRLGGIDNRGSHF
YLALYWAQELAAQSDDAQLAEAFTALAKSLAEQERTIVDELIAVQGSPADIGGYYQPSVE
KAAAVMRPSATFNEALATLA
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
gtgactgactcgaccatcatctatacgcacaccgacgaggctccggccctggcgacgcat
tccttcctgcccgtgatccaggcgtacgcccgggcggccggcgtcaccgtggaaacccgt
gacatctctctggccgggcgcatcatcgccggcttccccgagttcctcgaggagagccag
cgcatcgaggacgccctcgccgagctgggcgagctcgccaagacgccgggcgcgaacatc
atcaagctgccgaacatctcggcctcgatcccgcagctgaaggccgcggtcgccgagctc
caggcgcagggctacgcgctgccggactacccggacgacccgaagaccgagcaggacaag
gacgtccgcgcgcgctacgacaaggtcaagggcagcgccgtcaacccggtcctgcgcgag
ggcaactccgaccgccgcgcccccgcctcggtcaagaactacgccaagacccacccgcac
cgcatgggtgcctggagctccgactccaagaccaatgtcgcgaccatgggcgccgacgac
ttccgttccaccgagaagtccgcggtgatcgccgaggccggcacgctgcgcatcgagctg
gcggcggaggacggcaccaccaccgtgctgcgcgagtccgtgcccgtcctcgccggtgag
gtcgtcgacgcctccgtgatgcgcgtcgccgcgctgcgcgagttcctgacggcgcagatc
gcccgcgccaaggccgagggcgtgctgttctcggtgcacctgaaggccacgatgatgaag
gtctccgacccgatcgtcttcggccacgtggtgcgcgccttcttcccgaagaccttcgcg
aagtacggcgaggccctcgtcgcggccggcctgtcccccaacgacggcctcggcaccatc
ctcaagggcctggagtccgtgccgcacctgggcacggagatctcggcgtccttcgaggcc
gagctcgccgagggcccggccctggcgatggtcgactccgacaagggcatcaccaacctg
cacgtcccgagcgacgtcatcgtcgacgcctccatgccggccatgatccgcacctccggc
cacatgtggggcccggacggccaggaggcggacaccctcgcggtgctccccgacagcagc
tacgccggcgtctaccaggccgtgatcgaggactgccgtgcccacggcgccttcgacccg
tcgacgatgggctcggtcccgaacgtcggcctgatggcgcagaaggccgaggagtacggc
agccacgacaagaccttcgagatcgccgccgcgggcaccgtccgcgtcgtcgacgccgcg
ggcgccgtcgtgctggagcaggccgtgaacgccggcgacatcttccgcatgtgccaggcc
aaggacgcgccgatccgcgactgggtcaagctggccgtcacccgcgcccgcgccgccggc
gccccggccgtgttctggctcgacgagaaccgcgcgcacgacgcgcggctcatcgagaag
gtcaaggcgtacctgccggagcacgacaccgagggtctgcggatcgagatcatgtcgccc
gtcgaggcgacgaagttctcgctggagcgcatccgccgcggcgaggacacgatctccgtc
accggcaacgtcctgcgtgactacctgaccgacctgttcccgatcctggagctcggcacg
agcgccaagatgctgtcggtcgtcccgctgatgaacggcggcggcctgttcgagaccggc
gccggcggctccgcgccgaagcacgtccagcagctggtcaaggagaactacctgcgctgg
gacagcctgggcgagttcttcgcgctcgcggcgagcttcgagcacctcgcgcagaccacg
ggcaacgcgcgcgcccaggtgctcgccgacaccctcgaccgcgccacggccacgttcctc
aacgaggacaagtcgccgagccgccgcctcggtggcatcgacaaccgcggcagccacttc
tacctggcgctctactgggcccaggagctggcggcgcagagcgacgacgcccagctcgcg
gaggcgttcaccgcgctcgccaagtcgctggccgagcaggagcggacgatcgtcgacgag
ctgatcgccgtccagggctcgccggccgacatcggcggctactaccagccgtccgtcgag
aaggccgcggccgtcatgcgcccgtcggcgaccttcaacgaggcgctcgcgaccctcgcc
tga

DBGET integrated database retrieval system