KEGG   Salinimonas sp. KX18D6: FBQ74_06925Help
Entry
FBQ74_06925       CDS       T06006                                 

Gene name
recB
Definition
(GenBank) exodeoxyribonuclease V subunit beta
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
salk  Salinimonas sp. KX18D6
Pathway
salk03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:salk00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    FBQ74_06925 (recB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:salk03400]
    FBQ74_06925 (recB)
Enzymes [BR:salk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     FBQ74_06925 (recB)
DNA repair and recombination proteins [BR:salk03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     FBQ74_06925 (recB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase AAA_19 UvrD_C UvrD_C_2 PDDEXK_1 AAA_30 AAA_11 GatB_Yqey AAA_25
Motif
Other DBs
NCBI-ProteinID: QCZ93235
UniProt: A0A5B7YCH7
Position
1585416..1589027
Genome map
AA seq 1203 aa AA seqDB search
MSKGEVQTSAALDVVALPLHGRHLIEASAGTGKTFNITRLYLRLLLEKKLGVQQILVMTF
TNAATEEIRGRIAQTLDAALTYWQERRLNGPVEEDPVFAQLYDRFAGEEAEQLLQAALLE
LDEASVYTIHGFCNRILSELAFSGGAAMQLSLQTDTRELYLQAARDWIRHMSGKEEEYSL
LVLAGWHIPEQFLATFESAIRSGLSPRVVTAQEITEQAEAALADRQKALQPQFKQVRDTI
TSQYDVIADALIINDKNRALRESQFEEITAWLHAASVSPAPDALGKFVHGNRLRGKDDLK
ALLAPLKSLATEVKSAIDSIEKQRDAQLDAAPAMQVAAQAFAFIRAHVTRQKAQQGIVDF
DDLITMLAEKTDHADTELARALRRKFPAALIDEFQDTDANQYQILSSVYPPDSINEILLM
IGDPKQAIYGFRGGDIFTYLKAGRSADFRWVMDTNYRSVPAMVQSYNRLFYGAPLDGAPA
DVFGFDISYDPVNAAPTASANKTPLHDPETDRQALNYIALASDSTEDTPAKFVMQQQLAR
WIANEIVRLLQQARLGETPLKPQDIAILVRSAGEAKIIQQALQTAGLASVFLSNRENLFA
AGEARDLYRVLDGIWHYSDHGRLCAALSSPMFGLSHQTLIDLLYHENDQLWESVMETISL
LRRIWQQRGCMALILHLMEESFAAGGDEIERQLTNYLHLAEVLEREAATRAQPEQLLIWL
HRQISEPALAQEHVQRLESDAHLIQLITQHGAKGLEYPIVFVPFASDYRNPVKVGNQEVA
LFRYFDDTTNTLCLQLGATPDIKERVTQEADAEAMRLLYVAVTRAAHRCYLGVAPFDNHL
QSSLAKAADVGAYDSWEQAITRISQESGTSTALVHATDESHAQLSDISSEATPDLNVDTF
TGDVKEAWRLYSFSALARKERVVNQTRREAELQEILPQTMGEPESLPMRFSFQKGAAAGN
LLHDILEITDFSRPDWFSESQMTTLAPMTQLFGLDDAETEALFDWLQQVLDTPLNRNGLT
LSGLSKASTLREAEFYFPMANLSQQQLNQFLADYRQGQDHGARFFPAFDTHQLEGMMHGF
IDLIFEYEGKYFVADYKSTYLGDTFGDYLPEKLRHNNQHHLYDLQYLIYSVALHRYLQNS
LPDYSAQKHFGGVYYLYVRGMHPENENKEGVYFTPLSVSRLHALDRLFASQDSQNKAGES
VCS
NT seq 3612 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagggcgaggtgcaaaccagtgctgcgctggatgtcgtagctttacccttacat
gggcggcatcttatcgaagccagtgcgggaaccggcaaaacatttaatatcacacgcctt
tatttgcgcttgctactcgaaaaaaagctgggtgtacaacaaattctggtgatgacattt
accaatgccgccaccgaagagattcgcggcagaatagcgcagacactggacgctgcgttg
acgtactggcaagaacgtcgtcttaacgggccggtagaggaagatccggtttttgcccag
ctgtacgaccggtttgccggtgaagaggctgaacaattgcttcaggccgctttgcttgag
ctggatgaagcgtcggtgtacaccattcacgggttttgtaaccggatcttaagtgaattg
gcgttctcaggcggtgcagcaatgcagctttcgctgcaaactgacacgcgggagctttat
ctgcaggcggcccgggactggatccgccatatgtccggcaaggaggaggaatacagccta
ctggtgctagctggttggcatattccagagcaatttctggcgacctttgaaagtgctatt
cgcagtggtcttagtcctcgtgttgttaccgcgcaggagattaccgagcaggctgaggct
gcgctggcagaccggcaaaaggctctgcaaccgcaatttaagcaggtcagggataccatt
accagtcagtatgatgtgattgccgatgcactgattattaatgataaaaaccgtgcgtta
agagaatcccaatttgaggagatcaccgcctggctgcacgctgcatctgtcagtccggca
ccagatgcactgggtaagtttgttcacggcaatcgtttgcgaggcaaagacgatctcaaa
gcgttactggcgccgctgaagtccctggctactgaggtaaaatctgccatcgatagcatc
gaaaagcagcgtgatgcacagcttgacgctgcgccggcgatgcaggtggcagcacaggca
ttcgccttcattcgtgcacatgttacccgacagaaggcacagcaggggattgtcgatttt
gacgatcttattaccatgctggcagaaaaaaccgaccatgcagatacggaactggcacga
gcattacgccgcaaattccccgccgcgttaattgatgagtttcaggataccgatgctaac
cagtatcagattttatccagtgtttacccacccgatagtatcaatgaaattttgttgatg
attggcgatcctaaacaagctatttacgggtttcgcggcggcgatatatttacctatctc
aaagccggcagaagtgcagactttcgttgggtgatggacaccaattatcgttcggtgcca
gcgatggtgcaaagttataaccgcttattctacggtgcacctttagatggggcgccggca
gatgttttcggctttgacataagctatgacccggttaacgccgcccctacggccagtgct
aacaaaacacccttacatgatccggagactgaccggcaggcgcttaactatatcgcttta
gcgtcagatagcaccgaggacacgccagcgaaatttgtgatgcaacagcagcttgcccgg
tggattgcaaatgagattgtgcgcctgctgcagcaggccagactgggcgagacgccactt
aagccacaggatatagccattcttgtgcgcagtgccggtgaggcaaagattattcagcag
gcattgcaaacagccggactggcgtctgtttttctcagcaacagagaaaacctttttgca
gccggagaggccagggatctctatcgcgttctggacggtatctggcattacagtgatcat
ggtcgattatgtgcagccctgagtagtcctatgttcggattgtctcatcagacccttatt
gacctgctctatcacgaaaatgaccagctttgggagtcggtcatggagaccatcagcctg
ctgcgccggatttggcagcaacgaggttgtatggccctgatactccatcttatggaagag
tcttttgcagcgggtggcgatgagattgagcgccagctcaccaactatctgcatttggca
gaagtacttgaacgtgaagctgctacacgtgctcagcctgagcaattactaatctggctg
catcgtcaaatcagtgagccagcgctggcacaggagcatgtgcaacgccttgaaagtgat
gcgcatttgattcagctgataacgcaacacggcgctaaagggttggaatatcctattgtg
tttgtgccattcgccagcgactatcgcaatccggtcaaagtcggtaatcaggaagtcgcg
ctttttcgctactttgatgacacaactaacacgttatgcctgcaactgggtgcaactccc
gatattaaggagcgtgtcacccaggaagctgatgcagaagctatgcgcctgctttatgtg
gctgttacccgtgcggcccaccgttgctatctgggggttgcgccgtttgataatcacctg
caatcgtctcttgccaaagccgctgatgttggtgcgtatgatagctgggagcaggcgatt
acccgtatcagtcaggaatctggcacatcgacagcgttagtccatgctaccgacgagtcc
catgctcagctatcagacatctcatcagaagccactccagatctcaacgtagatacgttt
accggtgacgtaaaagaggcatggcgactgtactcgttttctgcactggccagaaaagag
agggtggtaaaccagacccgacgggaggccgagctacaggagatacttccgcagacaatg
ggagagccagagtcattaccaatgcgcttttcatttcaaaaaggcgctgcagccggtaac
ttactgcatgatattcttgagatcacagacttcagtcgtccagactggttcagtgagtcg
cagatgacaacactggcgcctatgacacagttgtttggtctggatgatgctgaaactgag
gcgctgtttgactggctgcaacaagttctggacacgccgttaaacagaaatggccttaca
ctctcggggctgagtaaagcgtccaccctgcgcgaggcggagttttattttcccatggca
aatctcagccagcagcagcttaaccagtttctggccgattaccggcagggacaggatcat
ggcgcccgatttttccctgcattcgatacgcatcagttagaaggcatgatgcatggtttt
attgatttgatttttgagtatgagggtaaatactttgtcgctgattataagtccacctat
ctgggcgatacattcggtgactatttgccagaaaagctacgccacaataatcagcaccat
ctctacgatctgcagtatcttatttacagcgtggcactacatcgttatctgcaaaatagc
ttacctgattattcagcacaaaagcattttggcggtgtttattatctttatgtacgcggt
atgcacccggaaaacgagaacaaagaaggcgtgtactttacgcctctttctgtttcacga
ttacatgccctggaccgccttttcgccagtcaggacagtcagaataaagcgggagaaagc
gtatgcagttaa

DBGET integrated database retrieval system