KEGG   Salinimonas sp. KX18D6: FBQ74_15890Help
Entry
FBQ74_15890       CDS       T06006                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
salk  Salinimonas sp. KX18D6
Pathway
salk03010  Ribosome
Brite
KEGG Orthology (KO) [BR:salk00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    FBQ74_15890
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:salk03011]
    FBQ74_15890
Ribosome [BR:salk03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    FBQ74_15890
  Bacteria
    FBQ74_15890
  Archaea
    FBQ74_15890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: QCZ94858
Position
complement(3545501..3545833)
Genome map
AA seq 110 aa AA seqDB search
MEALAKHRFARTSAQKARLVADQVRGMHVEKALELLTYSSKKSAGLVKKVLESAIANAEH
NEGADIDELRIAKIFVDEGPTMKRIKPRAKGRADRIFKRSSHITVVVADN
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaagcattagctaaacaccgttttgcccgcacgtcggctcaaaaagcacgcttggtt
gcggatcaggttcgcggaatgcacgtagaaaaagcacttgagcttttaacgtacagctct
aagaagagcgcaggactggtcaagaaagtacttgaatctgctattgcaaatgcagagcac
aatgaaggtgctgatattgacgagctgcgtatcgctaagatcttcgttgacgaaggtcca
acaatgaagcgtatcaagccacgtgcgaaaggacgtgcagaccgtatctttaagcgtagc
agtcacatcactgtggttgtagcggataactag

DBGET integrated database retrieval system