KEGG   Streptomyces albulus ZPM: SAZ_09535Help
Entry
SAZ_09535         CDS       T03896                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
sall  Streptomyces albulus ZPM
Pathway
sall00471  D-Glutamine and D-glutamate metabolism
sall01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sall00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SAZ_09535
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sall01011]
    SAZ_09535
Enzymes [BR:sall01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     SAZ_09535
Peptidoglycan biosynthesis and degradation proteins [BR:sall01011]
 Precursor biosynthesis
  Racemase
   SAZ_09535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race DUF2201 Glyco_transf_4 Peripla_BP_1 DUF498 DUF3549
Motif
Other DBs
NCBI-ProteinID: AKA02635
Position
complement(2210322..2211119)
Genome map
AA seq 265 aa AA seqDB search
MKIALMDSGTGLLPAAAAVRRLRPDADLVLSTDPDGLPWGPRTPDDVTAHALAVARAAAA
HRPDALIVACNTASVHALPALRAALEPDIPVIGTVPAIKPAAAGGGPVAIWATPATTGSP
YQRDLIARFAQGVEVAGVPCPGLADAVEQADDAAIEAAVTAAAQHTPREVRAVVLGCTHY
ELVAERIRAAVQQAGNPPLVLHGSAEAVAAQALRRIGAEPAPAAAPTGTLSVLLSGRPGA
LPEVVLAYEEGRLLAGAVPAAPYTA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatcgcgctgatggactccggaaccggcctgctcccggcggccgccgccgtacgg
cgcctgcggcccgacgcggacctggtgctctccaccgaccccgacggcctgccgtggggc
ccgcgcacccccgacgacgtcaccgcgcacgccctggccgtggcccgggccgccgccgcg
caccgaccggacgcgctgatcgtcgcctgcaacaccgcctcggtgcacgcgctgcccgcg
ctccgcgccgcactggaaccggacatcccggtcatcggcaccgttccggcgatcaagccc
gccgcggccggcggcggcccggtcgccatctgggccaccccggccaccaccggcagcccg
taccagcgggacctcatcgcccggttcgcccagggcgtcgaggtcgccggcgtgccctgc
ccgggcctcgccgacgcggtcgagcaggccgacgacgccgcgatcgaggccgcggtgacg
gccgccgcgcagcacaccccgcgcgaggtccgggccgtcgtcctgggctgcacccactac
gaactggtcgccgagcgcatccgcgccgccgtccagcaggccggcaatccgccgctggtg
ctgcacggctcggccgaggcggtcgccgcccaggcgctgcgccgcatcggtgccgagccg
gcccccgcggccgctcccaccgggaccctcagcgtgctcctcagcggccgtccgggtgcc
ctgcccgaggtggtcctggcctacgaggagggccggctgctcgccggtgccgtcccggcc
gcgccgtacaccgcctga

DBGET integrated database retrieval system