KEGG   Streptomyces albulus ZPM: SAZ_24945Help
Entry
SAZ_24945         CDS       T03896                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
sall  Streptomyces albulus ZPM
Brite
KEGG Orthology (KO) [BR:sall00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    SAZ_24945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Myc_target_1
Motif
Other DBs
NCBI-ProteinID: AKA05333
Position
5671448..5672446
Genome map
AA seq 332 aa AA seqDB search
MDTFALIVTIAVALGFTYTNGFHDSANAIATSVSTRALTPRAALAMAAVMNLAGAFLGSG
VAKTVSEGLIATPHGSKGMGILFAGLLGAVVWNLVTWYFGLPSSSSHALFGGLVGAALAG
GTQVIWSGVIEKVVLPMFISPVIGLVLGYLVMVAILWLFRKANPHKAKRGFRIAQTVSAA
GMALGHGLQDAQKTMGVVVMALVIADVETADDAIPLWVKLACAITMSLGTYAGGWRIMRT
LGRRIIELDPPQGFAAETTSASVMYVASFLFHAPISTTHVITASIMGVGSTKRPRAVRWG
VAKNIVMGWFITMPAAALVAALVFWLIKLAFG
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggacaccttcgcgctcatcgtgaccatcgcggtcgcgctcggattcacctacaccaac
ggcttccacgactcggcgaacgcgatcgcgacctcggtctcgacgcgcgccctgaccccg
cgggccgcgctggcgatggcggccgtgatgaacctcgccggtgccttcctgggcagcggc
gtcgccaagacggtcagcgaggggctgatcgcgaccccgcacggcagcaaggggatgggc
atcctcttcgccgggctgctcggcgcggtcgtctggaacctcgtcacctggtacttcggc
ctgccgtcctcgtcctcgcacgcgctcttcggcggcctggtcggcgcggcgctggccggc
gggacgcaggtgatctggtccggcgtgatcgagaaggtcgtcctgccgatgttcatctcg
ccggtgatcgggctggtgctcggctacctggtgatggtggccatcctctggctgttccgg
aaggccaacccgcacaaggccaagcgcggcttccgcatagcgcagaccgtctcggcggcg
ggcatggcgctcgggcacggtctccaggacgcccagaagaccatgggcgtcgtggtgatg
gcgctggtcatcgccgacgtcgagacggccgacgacgccattccgctgtgggtcaagctg
gcctgcgcgatcaccatgtcgctcggtacgtacgcgggcggttggcggatcatgcggacc
ctgggccggcggatcatcgagctggacccgccgcagggcttcgccgcggagaccacgtcc
gcctcggtgatgtacgtggcgtcgttcctgttccacgcgccgatctccaccacgcacgtc
atcaccgcctcgatcatgggcgtcggctcgaccaagcgcccgcgtgcggtgcgctggggc
gtggccaagaacatcgtgatgggctggttcatcacgatgccggccgcggcgctcgtcgcc
gccctggtgttctggctgatcaagctggccttcggctga

DBGET integrated database retrieval system