KEGG   Streptomyces albulus ZPM: SAZ_25385Help
Entry
SAZ_25385         CDS       T03896                                 

Definition
(GenBank) cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
sall  Streptomyces albulus ZPM
Pathway
sall00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:sall00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SAZ_25385
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sall01007]
    SAZ_25385
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sall03016]
    SAZ_25385
Enzymes [BR:sall01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     SAZ_25385
Amino acid related enzymes [BR:sall01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   SAZ_25385
Transfer RNA biogenesis [BR:sall03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    SAZ_25385
 Prokaryotic Type
    SAZ_25385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g DALR_2 tRNA-synt_1f tRNA-synt_1
Motif
Other DBs
NCBI-ProteinID: AKA05412
Position
5755087..5756481
Genome map
AA seq 464 aa AA seqDB search
MTIRLYDTSARQIRDFTPLRPGCVSIYLCGATVQAAPHIGHIRSGLNFDIMRRWFAHRGY
DVTFVRNVTDIDDKIIQKSAEQGRPWWAIGYENEVAFNAAYDALGCLRPTYEPRATGHIP
EMIEMMRGLIERGHAYAADGNVYFDVRSFPEYLQLSNQELDNLRQPSGEGETGKRDSRDF
AMWKAAKEGEPSWETPWGRGRPGWHLECSAMAHKYLGSAFDVHGGGVDLVFPHHENEIAQ
AKAYGDDFARYWSHNAWVTMSGEKMSKSLGNSVLVSEMVKRWRPIVLRYYLGTPHYRSMI
EYSEEALREAESSFARIEGFVQRVVEKAGTVEPAAEVPLAFAEAMDDDLGVPQALAIVHT
TVRQGNSALTADDKDAAVARLAEVRAMLGVLGLDPLDERWTGGGADRGEDLHGVVDSLVR
LVLEQRQGARARKDYATADAIRDQLQQSGLTIEDTPSGPRWSLT
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtgacgattcgcctgtacgacaccagcgcccggcagattcgcgacttcaccccgctccgg
ccgggctgtgtctcgatctacctctgtggtgcgaccgtgcaggctgccccgcacatcgga
cacatccggtcgggactcaacttcgacatcatgcgccgctggttcgcccaccgcggctac
gacgtgacgttcgtccgcaacgtcacggacatcgacgacaagatcatccagaagtcggcc
gagcagggccgcccctggtgggcgatcggctacgagaacgaggtcgccttcaacgcggcc
tacgacgccctcggctgcctgcgccccacctacgagccgcgggccaccggccacatcccc
gagatgatcgagatgatgcggggcctgatcgagcgcggccacgcctacgccgccgacggc
aacgtctacttcgacgtgcgctccttcccggagtacctccagctctccaaccaggagttg
gacaacctccgccagccgtccggcgagggcgagaccggcaagcgcgactcgcgcgacttc
gccatgtggaaggcggccaaggagggcgagcccagctgggagaccccctggggccgcggc
cggccgggctggcacctggagtgctcggcgatggcccacaagtacctgggctccgccttc
gacgtccacggcggcggcgtcgacctggtcttcccgcaccacgagaacgagatcgcgcag
gccaaggcgtacggcgacgacttcgcccggtactggtcgcacaacgcctgggtgaccatg
agcggcgagaagatgtccaagtcgctgggcaactccgtgctggtctcggagatggtcaag
cgctggcggccgatcgtgctgcgctactacctcggcaccccgcactaccgctcgatgatc
gagtacagcgaggaggcgctgcgcgaggccgagtcgtcgttcgcgcggatcgagggcttc
gtccagcgcgtcgtggagaaggccgggaccgtcgagccggcggccgaggtgccgctggcg
ttcgccgaggcgatggacgacgacctgggcgtcccgcaggcgctggcgatcgtgcacacc
accgtccggcagggcaattcggcgctgaccgcggacgacaaggacgccgcggtcgcccgg
ctcgccgaggtgcgggcaatgctcggcgtgctcggcctggacccgctcgacgagcggtgg
acgggcggcggcgcggaccgcggcgaggacctgcacggggtcgtggactccctcgtccgg
ctggtcctggagcagcggcagggcgcccgggcccgcaaggactacgcgaccgccgatgcc
atccgcgaccagctccagcagtccggcctgaccatcgaggacaccccttcgggcccgcgc
tggtcgctgacctga

DBGET integrated database retrieval system