KEGG   Streptomyces albulus ZPM: SAZ_39525Help
Entry
SAZ_39525         CDS       T03896                                 

Definition
(GenBank) glucose-1-dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
sall  Streptomyces albulus ZPM
Pathway
sall00030  Pentose phosphate pathway
sall01100  Metabolic pathways
sall01120  Microbial metabolism in diverse environments
sall01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sall00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SAZ_39525
Enzymes [BR:sall01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     SAZ_39525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR DUF1421 Glyco_transf_4
Motif
Other DBs
NCBI-ProteinID: AKA07792
Position
complement(8933121..8933960)
Genome map
AA seq 279 aa AA seqDB search
MSVPQGAPQGVIPTQLLKGQKALVTGGNSGIGKATAIGLGRAGADVVVNYVAGREAAEQV
AEEISGFGVRAAAYEADVSQEDQVVAMTQRMVEEFGTVDILVANAGLQRDAPFTKMTTAQ
WQKVLDVNLTGQFLCAREATKEFLRRGVVPEVSRAAGKIICMSSVHQLIPWAGHVNYAAS
KGGVQMMMTTLAQELAPRRIRVNAVAPGAIRTPINRSAWDTPDAEQDLLQLIPYGRVGDP
EDIAHAVVGLASDLMDYVVGTTLYVDGGMTLFPGFATGG
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtcccccagggtgcccctcagggcgtcatccccacgcaactgctgaagggccag
aaggcactggtcaccggcgggaactcgggcatcggcaaggcgacggccatcggcttgggc
cgcgccggagccgacgtggtcgtgaactacgtcgccggacgggaggcggcggagcaggtg
gccgaggagatctccggtttcggcgtgcgcgcggcggcgtacgaggccgacgtgtcccag
gaggaccaggtcgtcgcgatgacccaacggatggtcgaggagttcgggaccgtcgacatc
ctcgtggccaacgccgggctccagcgcgacgccccgttcaccaagatgacgacggcccag
tggcagaaggtcctggacgtcaacctcaccggccagttcctgtgcgcgcgcgaggcgacc
aaggagttcctgcggcggggggtcgtccccgaggtgtcgcgcgcggccggaaagatcatc
tgtatgagttcggtccaccagctgatcccgtgggccggtcacgtcaactacgccgcgtcc
aagggcggcgtgcagatgatgatgacgaccctcgcccaggagctggcgccccgcaggatc
agggtcaacgccgttgcgccgggagccatcaggacgcccatcaaccgcagtgcctgggac
actccggacgccgagcaggacctgttgcagctgattccgtacggacgcgtcggcgatccg
gaggacatcgcccacgcggtcgtcggcctcgcctcggacctcatggactacgtggtgggc
accaccctctacgtggacggcggcatgaccctgttccccggtttcgccaccggcggctga

DBGET integrated database retrieval system