KEGG   Salinimonas sediminis: D0Y50_03080Help
Entry
D0Y50_03080       CDS       T05624                                 

Gene name
apaG
Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
salm  Salinimonas sediminis
Brite
KEGG Orthology (KO) [BR:salm00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    D0Y50_03080 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AXR05439
UniProt: A0A346NIT2
Position
complement(687880..688272)
Genome map
AA seq 130 aa AA seqDB search
METRAVGHDAIVKVEVKTRHLAEHPAAKKGQFAFAYQITITNHSDVKVQLINRYWLITDG
GGKRSEVEGAGVVGKQPTLAPGDDFQYTSGAIIDTPVGTMEGYYEMECEDGEMLRIPIEV
FRLAVPNSIN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atggagacccgcgctgtgggacatgatgccatagttaaagtagaggtgaaaacccgccac
ctggcggaacatcctgccgcaaaaaaaggacagttcgcctttgcctatcaaatcacaatt
accaatcatagcgatgtaaaagtgcagctgattaaccgttactggctgattaccgatggc
ggcggtaaacgctccgaggtagaaggtgccggcgtggtaggtaaacagcctactctggcc
ccgggcgatgattttcagtataccagcggcgctattatcgatacgcccgtaggaaccatg
gaaggatactatgaaatggaatgcgaagacggtgaaatgttgcgcattccgatcgaagtg
tttcgcttagcagtacccaatagtattaattaa

DBGET integrated database retrieval system