KEGG   Salinimonas sediminis: D0Y50_04930Help
Entry
D0Y50_04930       CDS       T05624                                 

Definition
(GenBank) homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
salm  Salinimonas sediminis
Pathway
salm00270  Cysteine and methionine metabolism
salm00920  Sulfur metabolism
salm01100  Metabolic pathways
salm01110  Biosynthesis of secondary metabolites
salm01130  Biosynthesis of antibiotics
salm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:salm00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    D0Y50_04930
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    D0Y50_04930
Enzymes [BR:salm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     D0Y50_04930
    2.3.1.46  homoserine O-succinyltransferase
     D0Y50_04930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS
Motif
Other DBs
NCBI-ProteinID: AXR05781
UniProt: A0A346NJS4
Position
1084831..1085769
Genome map
AA seq 312 aa AA seqDB search
MPIRIPEQLPAQDVLLGENIFTMDSMRAANQDIRPLAVGILNLMPNKIETEVQLLRLLSN
TPLQIDVDLIRIDNQAPKNTPQSHMDSFYHDFSSIASKRYDGLIVTGAPLAHLEYSEVKY
WDTMAKILDWSERHVQSTLYLCWAAHAAMYHFYQVERVLRQEKISGVFEHEVLDPHNELM
RGFDPYFYAPHSRYGHITVDEYNQVPGLSVIARSADAGAYIVSSQDKRKVFVTGHPEYDP
ETLNDEYCRDVESGQAPQVPVNYYPDDNPAKNPLVRWRSHGSLLFTNWLNYCVYQNTPYD
LNLLANGASPKR
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgccgattcgaattcccgagcaactccccgcccaggatgtcctgctaggtgagaatatc
ttcaccatggatagcatgcgtgcagcgaaccaggacattcgtccgctggccgtcggtata
ctgaatttaatgccgaataaaatagagaccgaagttcagctgttgcgattgctctccaac
acgccattgcagattgatgtagatttaatccgcatcgataaccaggccccgaaaaatacg
ccgcagtcgcatatggactcgttttatcatgacttttccagtattgcttccaagcgttac
gatggactgatagtgaccggcgcccccttagcgcatttggaatacagtgaagtaaaatac
tgggataccatggcgaaaattcttgactggtcggaacgtcatgtccagtcaaccctgtat
ttgtgttgggccgcgcatgctgccatgtatcacttttatcaggtggaacgggtgctgcgc
caggaaaaaatatcgggtgtgtttgaacatgaagtattagacccgcacaacgaactgatg
cgcggttttgacccgtatttttatgcgccgcactcgcgctatgggcacattacggtggat
gagtacaaccaggtgccggggttaagtgttattgcacgttcagccgacgccggcgcctat
atcgtgtcatcccaggacaagcgcaaagtatttgttaccggacatccggaatacgatcct
gaaacgcttaacgacgaatattgtcgggatgttgagtcaggacaagcgccacaagttccg
gttaactattatcctgatgataatccggcgaaaaatccgttagtgcgctggcgctcgcat
ggtagcctgctgtttactaactggctaaactattgtgtttatcaaaatacgccgtacgac
ttaaatttgctcgctaacggcgcaagccccaagaggtaa

DBGET integrated database retrieval system