KEGG   Salinimonas sediminis: D0Y50_05040Help
Entry
D0Y50_05040       CDS       T05624                                 

Gene name
oadA
Definition
(GenBank) oxaloacetate decarboxylase subunit alpha
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
salm  Salinimonas sediminis
Pathway
salm00620  Pyruvate metabolism
salm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:salm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    D0Y50_05040 (oadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:salm02000]
    D0Y50_05040 (oadA)
Enzymes [BR:salm01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     D0Y50_05040 (oadA)
Transporters [BR:salm02000]
 Other transporters
  Primary active transporters [TC:3]
   D0Y50_05040 (oadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 RnfC_N DUF5089 DUF4060
Motif
Other DBs
NCBI-ProteinID: AXR05797
UniProt: A0A346NJU0
Position
1109498..1111333
Genome map
AA seq 611 aa AA seqDB search
MTTPLALTELVLRDAHQSLLATRMRLEDMLPIAKELDDAGFWSVESWGGATFDACIRYLG
EDPWERIRELKKAMPKTRQQMLLRGQNLLGYRHYADDVVTRFVERAHDNGVDVFRIFDAM
NDVRNLHTAVKAAIDCGAHAQGTISYTVSPVHTLDTWLTMAKQLEDMGVHSICIKDMAGL
LKPYECETLITSLKDTVNVPIAMQCHATTGLSTATYQKAVDAGIDMLDTAISSMSMTYGH
TATETMVSIVEGTARDTGLSLPQLEPIAAYFRQVRKKYAQFEGSLKGVDARILLAQVPGG
MLTNMESQLKEQGAEDKFDEVLKEIPKVREDLGFIPLVTPTSQIVGTQSVLNVLTQERYK
SITKETAGVLKGEYGATAAPVNETLQKRVLDGHSAITCRPADNIAPELEKLTEELAQLAQ
TKQFSLANDSIDDVLTYALFPQIGLKFLQNRGNPAAFEPAPEANAQPSQAVTAKTEQASA
GKAAQQSGPTAYDVKVDGKVFHVEVAASGEITNLTSAPSGSAESGEPAANKNEPSAQTDT
NAQAIEAPLSGNVFKLMVSVGDVVQDGDVIMIMEAMKMETEIRSAFNGTVSRILVKEGDA
VASAQPLIELE
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgactacacctctggcgttaactgaacttgtcttgcgtgatgcccatcagtctttgttg
gccacgcggatgcggcttgaagacatgctacctatcgccaaagagctggacgatgcgggg
ttctggtctgttgaatcctggggtggcgcaacgtttgatgcgtgtattcgctacctgggg
gaagatccatgggaacgtatccgagagctgaaaaaagccatgccaaaaacccgccagcag
atgttactgcgcgggcaaaatctacttgggtatcgtcattatgccgatgatgtagtcacc
cgctttgtggaaagggcacatgacaacggtgtagatgtgtttcgtatatttgatgcgatg
aacgatgtgcgcaatttgcacaccgcggtaaaagctgccattgactgcggcgcgcatgcc
cagggcaccatatcctatacggtaagcccggtacatacattggatacctggctgactatg
gccaaacagcttgaagatatgggggtgcattcaatctgtataaaagatatggccgggcta
cttaaaccctacgaatgcgaaacgttaattacctcacttaaagataccgttaacgtgccc
atcgccatgcaatgtcatgccaccaccgggctgtcgaccgctacctaccaaaaggcggtc
gatgccggcattgatatgctggatacggcaatttcctcaatgagcatgacctatggtcat
acagccaccgaaaccatggtgtctattgttgaaggtaccgcacgggataccggcctatcg
ttaccacagttggaacctatcgctgcttattttcgccaggtgcgtaaaaaatatgcccag
tttgaaggtagcctgaaaggtgtagatgcgcgaattttattggcgcaggtaccgggcggc
atgctaaccaacatggaaagccagttgaaggagcagggcgcggaagataaatttgatgaa
gtattaaaagaaattcccaaagttagagaagatctgggctttattcccctggtcacgccc
acctcgcaaattgtcggcacgcagtctgttttaaatgtgctaacccaggaacgttataaa
agcattaccaaagaaactgccggggtgctaaaaggggagtatggggctacggcagcaccg
gtcaatgaaacgctgcagaagcgcgtactggacggccacagcgctattacttgtcgaccg
gcagataacatagccccggagctggaaaagctcacagaggagcttgcacaacttgcgcaa
acaaaacagttctcactggcaaacgacagcatagatgatgttttaacctacgccttattt
ccgcaaattggtctgaaatttctgcaaaaccgcggcaatccagccgcttttgaacctgct
ccggaggctaatgcacagcccagccaggctgttactgccaaaactgaacaggcatcagcc
ggtaaggcagcccaacagagcggccccaccgcttatgatgtcaaggtagacggcaaggta
tttcatgttgaagtagccgccagcggcgaaataacgaatctaacatcggccccgtcaggt
agtgctgagtcaggtgagcccgctgccaataaaaacgaaccatcggctcaaactgacact
aacgctcaggctattgaagcgcctttgtcggggaatgtgtttaagttaatggtcagtgta
ggcgatgtagtgcaagacggtgatgtcatcatgattatggaagccatgaaaatggaaacc
gaaatacgcagtgcgtttaacggaacagtaagtcggattctggtcaaagaaggcgatgcg
gtcgccagcgcccaaccgctaattgaactggaataa

DBGET integrated database retrieval system