KEGG   Salinimonas sp. N102: D0Y50_14475Help
Entry
D0Y50_14475       CDS       T05624                                 

Gene name
gcvT
Definition
(GenBank) glycine cleavage system aminomethyltransferase GcvT
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
salm  Salinimonas sp. N102
Pathway
salm00260  Glycine, serine and threonine metabolism
salm00630  Glyoxylate and dicarboxylate metabolism
salm00670  One carbon pool by folate
salm01100  Metabolic pathways
salm01110  Biosynthesis of secondary metabolites
salm01130  Biosynthesis of antibiotics
salm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:salm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    D0Y50_14475 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    D0Y50_14475 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    D0Y50_14475 (gcvT)
Enzymes [BR:salm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     D0Y50_14475 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C POPLD
Motif
Other DBs
NCBI-ProteinID: AXR07450
UniProt: A0A346NPJ3
Position
complement(3281200..3282279)
Genome map
AA seq 359 aa AA seqDB search
MSSKTALHAKHLEAGAKMVDFFGWEMPISYGSQIEEHHAVRQDAGMFDVSHMTIVDVTGE
QARPYLRYLLANDVAKLQDKGKALYSGMLNEAGGVVDDLIVYHFDATNYRLVVNSATREK
DMNWLLSKAEGFAVTITEKPDFAMLAVQGPGAKDKAANLFSEAQKEAVAGMKPFYGVQAE
DLFIATTGYTGEAGYEIMVPVARAAQFWQELLNAGVKPCGLGARDTLRLEAGMNLYGQDM
DETISPLAANMGWTITWEPAERNFVGRQALETLKAQGTDKLVGLVMKEKGVLRAGQKIKT
DNGEGVITSGTFSPTLGHAIAMARIPAGTPATVEVEMRKKWVTVDVVKPCFVRNGKSAL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaaaactgcgcttcacgccaagcatctggaagccggtgcgaaaatggtggat
tttttcggttgggaaatgcccatcagctatggttcgcaaattgaagagcatcacgccgtg
cgccaagatgctggcatgtttgatgtgtcacatatgacgatagtagatgtgacgggcgaa
caggcccgaccttatctgcgttacttgctggccaacgatgtcgctaagctacaggacaag
ggcaaagcgctttacagtggaatgctgaatgaggctggcggcgtagtagatgacctgatt
gtatatcattttgatgccactaattatcgcttggtagtgaattcggctacccgcgaaaaa
gacatgaactggctgttgtcaaaagccgaaggctttgccgtcacaatcactgaaaagcca
gattttgcaatgctggcggtgcaggggccgggcgcaaaagacaaagccgctaacctgttc
agcgaagcgcaaaaagaagcagtggcgggaatgaaacccttctacggtgtgcaggctgaa
gatttgtttatcgccaccaccggctataccggtgaagccggctatgaaattatggtgccg
gtggctcgtgcggctcagttttggcaagaattacttaacgcaggggtgaaaccgtgtggg
ttgggcgcgcgtgatacgttgcgcctggaagccggtatgaacttgtacggtcaggacatg
gatgaaaccatatcacccctggccgccaatatgggctggaccattacctgggaaccggcc
gagcgtaactttgttggccgtcaggccctggaaacacttaaagcccaaggaaccgataag
ctggtggggctggttatgaaagaaaaaggcgtattgcgcgctggccagaaaattaaaaca
gataacggcgaaggtgtcatcacctccggtacattttcacctaccttaggccacgctatc
gcaatggcacgaattcctgccggcaccccggcaacggtagaggtggaaatgcgcaaaaag
tgggttacagtagatgtggttaagccctgctttgtacgcaatggtaaaagcgctttataa

DBGET integrated database retrieval system