KEGG   Salinisphaera sp. LB1: SALB1_0330Help
Entry
SALB1_0330        CDS       T05476                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
saln  Salinisphaera sp. LB1
Pathway
saln00450  Selenocompound metabolism
saln00970  Aminoacyl-tRNA biosynthesis
saln01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:saln00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SALB1_0330
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SALB1_0330
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:saln01007]
    SALB1_0330
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:saln03016]
    SALB1_0330
Enzymes [BR:saln01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SALB1_0330
Amino acid related enzymes [BR:saln01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SALB1_0330
Transfer RNA biogenesis [BR:saln03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SALB1_0330
 Prokaryotic type
   Other AARSs
    SALB1_0330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1 Ribosomal_60s
Motif
Other DBs
NCBI-ProteinID: AWN14537
UniProt: A0A2Z3J895
Position
366528..368618
Genome map
AA seq 696 aa AA seqDB search
MKTHDFEHVMARDILVTSALPYANGATHLGHMLEHIQTDIWVRFQKLRGHNCLAVCGDDA
HGTPIMLKARDQGISPEALIAGVSAERQRDFADFLVVYDNYYTTHSDENRELSAAIYEKL
AAEGHIARRTISQAFDPEAQMFLPDRFIRGDCPNCGSPDQYGDACEVCGATYQPTELGNP
VSVLSGATPIERDSEHYFFKLADFEGFLRDWMRGDRLQESMSRKLDEWFATGLRDWDISR
DAPYFGFKIPGTEDKYFYVWLDAPIGYMAAFQNLVDKRDDPELTFDRFWGRDSDAELYHF
IGKDIVYFHALFWPAMLEGAGFRTPDAIHAHGFVTVNGEKMSKSRGTFIKARTWLDHINP
EFLRYYFAAKLTHRVEDLDLNFEDFLARINSDLVGKYVNIASRCANFINKRFDGKLAAEL
DRPALVEHFAAVGEEIADHFEARRYAQGIRQIMALADEANAYVAERAPWQVAKEDGRDAE
LQAICTTALNLFRQLTIYLKPVLPVTAERAEAFLQIEPLVWADLNTPLLDHEIAKFKPLL
RRVEQPAIDKMIEASKEDLEAAAAPAQAEPEQAKEEKKQTTDAPKPAEDDGMIGIDDFAR
VDLRVARVESADHVEGADKLLCLQLDVGELGKRQVFAGIKSAYDPSALEGRLVALVANLA
PRKMRFGVSEGMVLAAGDSPHVLSPDEGAKPGDKIK
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaactcacgatttcgagcacgtcatggcgcgcgatattctggtcacctcagccctg
ccctatgccaacggcgcgacgcatctggggcacatgctggaacatatccagaccgatatc
tgggtccgcttccagaaactgcgcgggcacaactgcctcgcggtctgcggcgatgacgcg
cacggcacgccgatcatgctcaaggcgcgcgatcaggggatttcgcccgaggcattgatc
gccggcgtctcggccgagcgccagcgcgatttcgccgatttcctggtcgtctacgacaac
tactacacgacgcattccgacgagaaccgcgaactgtcggcggcgatctacgagaaactc
gccgccgagggccatatcgcccggcgcacgatctcgcaggcgttcgaccccgaagcgcag
atgttcctgccggatcgcttcatccgcggcgattgcccgaactgcggcagtcccgatcag
tacggcgatgcctgcgaagtctgcggcgcgacctaccagccgaccgaactgggcaacccg
gtgtcggtgttgtcgggcgccacaccgatcgaacgcgattcggaacattatttcttcaag
ctcgcggatttcgagggcttcctgcgcgactggatgcgcggcgaccgcttgcaggaatcg
atgagccgcaaactcgacgaatggtttgccaccggcctgcgcgactgggacatctcgcgc
gatgcgccctatttcggcttcaagattccgggcaccgaagacaagtatttctatgtctgg
ctggatgcgccgatcggctacatggcggcattccagaatctggtggacaaacgagacgat
ccggagctgacgttcgatcggttctggggccgcgattccgacgccgagctgtaccacttc
atcggcaaggacatcgtctatttccatgccctgttctggccggcgatgctggaaggcgcc
ggctttcgcaccccggatgcgattcatgcgcacggcttcgtcaccgtcaacggcgagaag
atgtcgaaatcgcgcggcaccttcatcaaggcgcgcacctggctggaccatatcaatccg
gaattcctgcgctactacttcgcggccaagctgacgcaccgggtcgaggatctggacctg
aacttcgaggactttctggcccggatcaattccgatctggtcggcaagtacgtcaatatc
gccagccgctgtgcgaacttcatcaacaagcgcttcgacggcaaactcgccgccgaactc
gaccggccggcactggtcgagcacttcgccgcggtcggcgaggaaatcgccgatcacttc
gaagcgcgccgctatgcccagggcatccgccagatcatggcgctggctgacgaagccaat
gcctacgtcgccgagcgcgcgccctggcaggtcgccaaggaagacggccgcgacgccgaa
ctgcaggccatctgcaccaccgcgctgaatctgtttcgccagctcacgatctacttgaag
cccgtgctgccggtcaccgccgagcgcgccgaggccttcctgcagatcgagccgctggtc
tgggccgacctgaacactccgctgctcgaccacgaaatcgccaagttcaagccgctgctg
cgccgcgtcgagcagccggcgatcgacaagatgatcgaggcgagcaaggaagatctggaa
gccgccgcggcgccggcccaggccgagccggaacaagcgaaggaagaaaagaaacaaacc
acggatgcgccgaagcctgctgaagacgacggcatgatcggcatcgacgatttcgccagg
gtcgacctgcgcgtcgcccgggtcgagtcggccgatcatgtcgagggcgcggacaagctg
ctgtgcctgcagctcgacgtcggagaactcggcaagcgccaggtcttcgccggcatcaag
tccgcctacgacccgagcgcgctggaaggccggctggtcgccctggttgccaatctcgcg
ccgcgcaagatgcgcttcggcgtctccgaaggcatggtgctggccgccggcgactcgccg
cacgtgctctcgccggacgagggcgccaagccgggtgacaagatcaagtaa

DBGET integrated database retrieval system