KEGG   Salinisphaera sp. LB1: SALB1_1676Help
Entry
SALB1_1676        CDS       T05476                                 

Definition
(GenBank) Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit A
  KO
K01028  3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
saln  Salinisphaera sp. LB1
Pathway
saln00072  Synthesis and degradation of ketone bodies
saln00280  Valine, leucine and isoleucine degradation
saln00650  Butanoate metabolism
saln01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:saln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SALB1_1676
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    SALB1_1676
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SALB1_1676
Enzymes [BR:saln01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     SALB1_1676
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans
Motif
Other DBs
NCBI-ProteinID: AWN15874
UniProt: A0A2Z3J3C2
Position
1804094..1804795
Genome map
AA seq 233 aa AA seqDB search
MNKQYASAAAALDGLIADGMTLAVGGFGLCGIPEALIAALRDTGKRELTVASNNAGVDGF
GLGLLLASRQIRKMISSYVGENKEFERQYLSGELELEFAPQGTLAERLRAGGAGIAAFYT
RTAYGTKIAEGKETREFDGHHYVMERGLPVDVALIKAEVADTVGNLRFAKTARNFNPLAA
TAGRVCVAEVERLVPAGEIGPDDIHLPGIYVDRIVVNAAPEKRIEKRTVSEAA
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagcaatacgcctcggcggcggccgcgctcgacgggctgatcgccgacggcatg
acgctggcggtgggcggcttcgggctgtgcgggattcccgaggccctgatcgcggccctg
cgcgataccggcaagcgcgaattgaccgtggccagcaacaatgcgggcgtcgatggcttc
ggcctggggctgctgttggcgtcgcgccagatccgcaagatgatctcgtcctacgtcggc
gagaacaaggaattcgagcgccagtatctgtccggcgagctggaactggaattcgccccg
cagggcacgctggcggagcggctgcgggccggcggcgctggtatcgcggcgttctatacc
cgcaccgcgtacggcaccaagatcgccgagggcaaggagacccgcgagttcgacggccat
cactatgtcatggaacgcggtcttcccgtggacgtcgccctgatcaaggccgaggttgcc
gacaccgtcggcaacctgcgctttgccaagaccgcgcgcaatttcaatccgctggcggcc
accgcaggccgggtctgtgtggccgaggtcgagcggctggtaccggccggcgagatcggc
ccggacgatatccatctgccgggcatctacgtcgaccgcatcgtggtcaatgccgcgccc
gaaaaacgcatcgagaaacgtaccgtgagcgaggccgcctga

DBGET integrated database retrieval system