KEGG   Salinisphaera sp. LB1: SALB1_2588Help
Entry
SALB1_2588        CDS       T05476                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase, R-alcohol forming, (R)- and (S)-acetoin-specific
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
saln  Salinisphaera sp. LB1
Pathway
saln00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:saln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SALB1_2588
Enzymes [BR:saln01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     SALB1_2588
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     SALB1_2588
    1.1.1.-  
     SALB1_2588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AWN16784
UniProt: A0A2Z3J669
Position
2823735..2824814
Genome map
AA seq 359 aa AA seqDB search
MKALRFHAARDLRIEEVEPPHDPAPGQVVVANRFCGICGTDLHEYAYGPIFIPTAPHPYS
KAQLPQTLGHEFGGVVTAVGEGVTSAAVGDRVSIQPLIMPRAGDYFADRGLFHLSERLAL
VGLSWDYGGMSGGALVNDYNVQVIPDDMSDEQAALVEPTAVAVYACDRGGVAAGSSVLVA
GAGPIGILVLLVARAAGATQLFISDVNPTRLKLAETAVPGVVAINAKSEPVGDVVRDHSE
GHVGCDVAIECAGNEQTLKSALDAVRKQGVIVQTGLHAGENPLNWFDVTFKDIDVRGSWC
YPTWYWPRVCRLIASGQIPSERAVTRRIPLDEAVAHGFDALLDPAGTELKILIDLENAA
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcactgcgattccacgccgcccgggatttgcggatcgaggaagtcgagcccccg
catgatccggcaccagggcaggtcgtcgtcgccaaccgcttttgcggcatctgcggcacc
gatctgcatgaatacgcctacgggcccattttcattccgaccgcgccccatccctactcg
aaagcgcagctaccgcagacgctgggccacgaattcggcggggtggtgaccgccgtgggc
gagggcgtgaccagcgccgcggtcggcgatcgggtttcgatccaaccgctgatcatgccg
cgtgccggcgattatttcgcggatcgcgggttgtttcatttgtccgagcggttggcgctg
gtgggcctgtcctgggattacggcggtatgtcgggtggcgcgctggtcaacgactacaac
gtgcaggtgatcccggacgacatgagcgacgagcaggctgcgctggtcgagccgactgcc
gtggctgtttatgcctgcgaccggggcggcgtggccgccggttccagtgtgctggtcgcc
ggggccggcccgattggcattctggtgctgcttgtcgcacgcgcggcgggcgccacgcag
ttgttcatctcggatgtgaatccgacccggctcaagctggcagagaccgcggtgcccggg
gtggtcgccatcaacgcgaagagcgaaccggtgggcgatgtcgtgcgcgaccatagcgaa
ggccatgtcggctgcgacgtcgccatcgaatgcgccggcaacgagcagacgctgaaatcg
gcgttggacgccgtgcgcaagcagggcgtgatcgtgcagaccgggctgcatgcgggcgaa
aacccgctcaactggttcgatgtgacgttcaaggacatcgacgtacgcggctcgtggtgc
tacccgacctggtactggccgcgtgtctgccggctgatcgccagcgggcagatcccgtcg
gaacgggcggtgacgcgccgtatcccactcgacgaggcggtcgcacacggcttcgacgcg
ctgctcgacccggccggcaccgaactcaagatcctgattgatctcgagaacgcggcctga

DBGET integrated database retrieval system