KEGG   Salinisphaera sp. LB1: SALB1_2675Help
Entry
SALB1_2675        CDS       T05476                                 

Definition
(GenBank) Phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
saln  Salinisphaera sp. LB1
Pathway
saln00564  Glycerophospholipid metabolism
saln01100  Metabolic pathways
saln01110  Biosynthesis of secondary metabolites
Module
saln_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:saln00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SALB1_2675
Enzymes [BR:saln01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     SALB1_2675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIA_1 PS_Dcarbxylase PDZ_6
Motif
Other DBs
NCBI-ProteinID: AWN16871
UniProt: A0A2Z3J6C5
Position
2923335..2924012
Genome map
AA seq 225 aa AA seqDB search
MQRKTLFQIVPEGWAALFVLAVVFLIVNATIDVWAALPVLVLMAVCVLFFRDSPRHAPAE
PLSVVAPVDGTVIHRRECYDPYLDREAVKVAIRVNPFGAYLLRSPVEGTVLELAGETVER
LGGVASMIRTDEGDELVMAIRRGSLLGERPCRNSYGERVGQGRCCGKRRLAQRVELFLPV
NCRMEVELGDHVRAGACVLAKLVHKKNGSCRARDDADRTRLDGAA
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgcaagacgctgtttcagatagtcccggaaggctgggctgcgctgttcgtgctg
gcggtcgtgtttctgatcgtcaatgcgaccatcgacgtgtgggcggcactgcccgtgttg
gtgctcatggcggtgtgcgtgctgttcttccgcgattcgccgcggcatgcgccggcggaa
ccgctgtcggtggttgcgccggtggatggcaccgtcattcaccggcgcgaatgctacgac
ccctatcttgatcgcgaggcggtcaaggtggccattcgggtgaatccgttcggcgcctat
ctgctgcgttcgccggtggagggcacggtgctggagctggcgggtgaaaccgtggagcgg
ctcggcggcgtggcctcgatgatccgcaccgacgagggcgatgaactggtcatggcgatc
cggcgcggcagcctgctgggcgaacgcccgtgccggaacagctatggtgagcgcgtgggc
caggggcgctgctgcggcaagcgtcggctggcacagcgggtggaattgttcctgcccgtg
aattgccgcatggaggttgagctcggcgatcatgtgcgtgccggggcctgcgtactggcc
aagctcgtgcacaagaagaacgggagctgtcgggcccgggacgatgccgatcggacccgg
ctggacggcgccgcctga

DBGET integrated database retrieval system