KEGG   Salinisphaera sp. LB1: SALB1_3066Help
Entry
SALB1_3066        CDS       T05476                                 

Definition
(GenBank) Exodeoxyribonuclease V gamma chain
  KO
K03583  exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
saln  Salinisphaera sp. LB1
Pathway
saln03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:saln00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    SALB1_3066
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:saln03400]
    SALB1_3066
Enzymes [BR:saln01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SALB1_3066
DNA repair and recombination proteins [BR:saln03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SALB1_3066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_V_gamma RecC_C
Motif
Other DBs
NCBI-ProteinID: AWN17260
UniProt: A0A2Z3JCB0
Position
complement(3364106..3367513)
Genome map
AA seq 1135 aa AA seqDB search
MFYLYHHNDLSRLAELFGALRGRRSRAPLAVDTVLAPNAGIGRWLRIQLAESEGIAANID
GRLPGAFIWDMLHATMDGADAGDHFEPDCLPWHLYAALPEIAREVPAVSDYLGTPVDEVR
RYQLARQLADVFDQYLVYRADMLAAWEAGEVPASNPGRWQARVWHWLTRDHRLGTTHRAR
VLTNFITRLGNEATLQQRVIDFCPDELYCFGLVALAPDHLRLLYALAEHIDVHFLLPNPS
AAYWGDITAGRLPLDLPAAASPDADTLLPGEAAVEAGHPLLSALGRMARDTLRVLYSDEF
AGMIEPELGDLMDYDIPRPDTLLHRVQADIVELDCSGSAQGMDDTDTSFEVHACHSPLRE
IQVLQDQLLDRLAADDKRVAAGEISEAERLAPRDIIVMLPDVAAYAPAIQAVFGGAPPER
YLPFGLADRARSAAHPIVTCVSALLDLPLSRWAASELLDLLAVPAVMRRFGLSAGELDAI
TKWIGEAGIRWGRDAHHRAGLGAGAFEQNSWRFGLDRLLLGVVQSDDETLTAGVAPWSDL
EGGITAALGKLWRFEDTLATVADGLAEPGTPGEWQTRLNAMVDRLIAPSMDAPDEQRAVD
SLRSVFARFDPAENCTRDKPLTADRRLSWPAVRDSLRATLETATERQPFLAGGITFCGMV
PLRAVPFRVVCVLGMNDSAFPRQDTGRAFNAMFDAPRLGDRNIRDDDRLLFLQALTAARD
AFYISYIGQDVNTGEELPPSPIVGETLEFLRRHYFRGEDKKRFERRLIHRQPMQPFSLRY
FSRHEPDARVFTYVNDWGDATRAAIGARRTREPLLDDSTAPIAEAIEVIDLDTLKRFFDH
PARVFFRERTQLNLEIEDRQVDDAEPVALDPLAAAQLRERLFESADKTNAPAIDLAPTAL
ERARGALPPPPLAAPNYAEQAEAVNELLPIWQAWKAEGTPETLDIQLDLVLPESHIVRVT
GRIAQCWPGAMRRLRTGKLKTRFRLRYWIDYLAAVAAGHVLDMHMAGFAPDKKTAERIEY
AGRVDAETAHTELAHLLQLYLAGQTRPLHYHPDLDDSYKPTQNKAFDNLSFRFKPAAYHP
HHLMRDPYFSMLLGPSEAPLGDTEDDSPFVAAIDAISGLMNQAIRPIESNAEAPA
NT seq 3408 nt NT seq  +upstreamnt  +downstreamnt
atgttctatctctatcaccacaacgatctgtcgcggctggccgagctgttcggcgcgttg
cgcgggcggcgatcgcgggcgccgctggcagtggataccgtactggcgcccaacgccggc
atcggccgctggctgcgtatccagctggccgaaagcgaaggcatcgccgccaacatcgac
ggccgcctgcccggcgcgttcatctgggacatgctgcacgccacgatggacggcgccgac
gcgggcgatcacttcgaaccggattgcctgccctggcatctgtatgccgcgctccccgag
atcgcgcgcgaggtgccggccgtgtcggattatctcggtacgccggtggacgaagtccgc
cgctaccagctcgcccgtcagcttgcggatgtctttgaccagtacctggtctatcgcgcc
gacatgctggccgcctgggaagctggggaggtgccggcgtccaaccccggccgctggcag
gcgcgcgtgtggcactggctcacgcgcgaccatcgcctcggcaccacgcaccgcgcccgc
gtgctcacgaacttcatcacacgcctgggcaacgaggcgacgctgcaacaacgcgtgatc
gatttctgtccggacgagctgtattgcttcggcctggtggcgctcgcacccgatcacctg
cgcctgctttacgcgctggccgagcatatcgatgtgcatttcctgctgccgaacccgagt
gctgcctactggggcgatatcaccgccggccggctgccgctcgatctgccggcggccgcc
agcccggacgcagacaccctgctgcccggcgaagccgcggtcgaggccggccacccgctg
ctgtccgcgctcggtcgcatggcgcgggatacgctgcgcgtgctgtattccgacgagttc
gcgggcatgatcgaacccgagctgggcgatctgatggattacgacatcccgcggcccgac
accctgctgcaccgggtgcaggccgacatcgtcgaactggattgcagcggctcggcccag
ggcatggatgacaccgacacctcgttcgaggtgcatgcctgtcacagcccgctgcgcgag
atccaggtgctgcaggaccagctgctggatcgcctggccgcggacgacaagcgcgtcgcg
gccggcgagatcagcgaggccgaacggctcgccccgcgcgacatcatcgtcatgctgccg
gatgtcgctgcctacgccccggcgatccaggccgtcttcgggggcgcgccgcccgagcgc
tacctgcccttcggcctggccgatcgcgcccgctcggcggcccatcccatcgtgacctgt
gtctcggccctgctcgacctgccgctgtcgcgctgggcggccagtgaactgctcgacctg
ctcgccgtgccggcggtcatgcgccggttcggcctctcggccggcgagctggatgcgatc
accaagtggatcggcgaggccggtatccgctgggggcgcgatgcccatcaccgggccgga
ctcggcgccggtgcgttcgaacagaacagctggcgcttcgggctcgaccgcctgctgctg
ggcgtcgtccagtccgacgacgaaacgctcaccgccggggtggcgccgtggtccgatctg
gaaggcggcatcaccgccgcgctcggcaaactctggcgcttcgaggacacgctcgccacc
gtcgccgacggcctcgccgagccgggcacgccgggcgaatggcagacgcggctcaacgcc
atggtggatcggctgattgcgccatcgatggacgcgccggacgaacaacgcgcggtcgat
tccttgcgcagcgtattcgctcgcttcgacccggctgaaaactgtacccgcgacaagccg
ctcaccgccgatcggcgcctgtcctggccggccgtgcgtgacagcctgcgcgccacactg
gaaaccgcgaccgagcgccagccgttcctggccggcggcatcaccttctgcggcatggtg
ccgctgcgcgccgtaccgtttcgcgtggtctgcgtgctgggcatgaacgattccgccttc
ccgcgccaggacaccggccgggccttcaacgccatgttcgacgccccgcggctgggcgat
cgcaacatccgcgacgacgaccgcctgctgttcctgcaggcgctcaccgctgcgcgcgat
gccttctacatcagctacatcggccaggacgtgaataccggcgaagaactgccgccctcg
ccgatcgtgggcgaaacactggaattcctgcgccggcattatttccggggcgaggataaa
aaacgcttcgagcgccggctgattcatcgccagccgatgcagccgttttcgctacgctac
ttctcgcgccacgagccggacgcccgcgtattcacctatgtcaacgactggggcgacgcc
acgcgcgcagcgatcggcgcccgccggacgcgcgaaccgctgctcgacgacagtaccgcc
ccgatagccgaagccattgaggtcatcgatctggacacgctcaagcgctttttcgaccac
ccggcccgggtcttcttccgcgaacgtacccaactcaatctcgagatcgaggatcgccag
gtcgacgacgccgaaccggtcgcgctcgacccgctggctgccgcgcaactgcgtgagcgc
ctgttcgaatccgccgacaagacgaacgcaccggcgatcgacctggccccgaccgcgctc
gaacgcgcccggggtgcgctgccgccgccacccctggccgcgccgaactatgccgagcag
gccgaggcggtcaacgaactgttgccgatctggcaggcgtggaaagctgagggcacgccg
gaaacgctggatatccagctcgatctggtccttcctgagtcgcatatcgtccgtgtaacc
gggcgcatcgcccagtgctggcccggggcgatgcgtcggctgcgcaccggcaagctcaag
acccgcttccgcctgcgctactggatcgattacctggccgcggtggccgccggccacgta
ctggatatgcacatggccggcttcgcccccgacaagaaaaccgcggagcggatcgaatac
gccggccgggtcgatgccgaaaccgcccacaccgagctggcgcatctgctgcagttgtac
ctcgcgggccagactcggccactgcactatcacccggatctggatgacagctacaagccg
acgcagaacaaggccttcgacaacctcagctttcgcttcaagcctgcggcctatcacccg
catcacctcatgcgcgatccgtatttttccatgctgctcggcccgtccgaggcaccgctc
ggcgacaccgaggacgacagccccttcgtcgcagcgatcgatgccatcagcgggctgatg
aatcaggcgatccgcccgatcgagagcaacgccgaggccccggcatga

DBGET integrated database retrieval system