KEGG   Silicimonas algicola: EF888_03935Help
Entry
EF888_03935       CDS       T05779                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
salo  Silicimonas algicola
Pathway
salo00450  Selenocompound metabolism
salo00970  Aminoacyl-tRNA biosynthesis
salo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:salo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    EF888_03935
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    EF888_03935
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:salo01007]
    EF888_03935
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:salo03016]
    EF888_03935
Enzymes [BR:salo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     EF888_03935
Amino acid related enzymes [BR:salo01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   EF888_03935
Transfer RNA biogenesis [BR:salo03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    EF888_03935
 Prokaryotic type
   Other AARSs
    EF888_03935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AZQ66354
UniProt: A0A316GFE9
Position
complement(768443..770158)
Genome map
AA seq 571 aa AA seqDB search
MARILITSAIPYINGIKHLGNLVGSQLPADLYARYMRARDHEVLFLCATDEHGTPAELAA
AKAGMPVADYCAEMHEVQTRLSDGFRLSFDKFGRSSSPQNHLLTQHFAGKLAENGLISEV
SEKQMYSNADGRFLPDRYIEGTCPNCGYDRARGDQCENCTKQLDPTDLIEPRSAISGSTD
LEVRETKHLYLKQRSLRGQLSEWIDSKTDWPVLTTSIARKWLNDGDGLQDRGITRDLDWG
IPVKKGAEDWPGMEGKVFYVWFDAPIEYIACAKEWSDARGAPDAEWERWWRTDKGADDVR
YVQFMGKDNVPFHTLSFPATIIGSGEPWKLVDYIKSFNYLNYDGGQFSTSQGRGVFMDQA
LSILPADYWRWWLLSHAPENSDAEFTWENFQASVNKDLADVLGNFVSRVTKFCRSKFGEE
VPSGGDWGAEEDALIARLSEGVARYEAAMEAIEVRKAAGELRAIWVAGNEYLQSAAPWSV
FKDDPDRAAAQVRLALNLIRVYAVLSAPFIPDAAGSMLSAMNTLDTDWPSDMRAALTALP
PGHAFTVPEVLFKKIADEEREDWQTGFAGQR
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcatcctcatcaccagcgccattccctacatcaacgggatcaagcacctgggg
aacctggtcggctcgcagctgcccgccgacctctatgcgcgctacatgcgcgcccgcgac
cacgaggtgctgttcctctgcgccaccgacgagcacggcacgccggccgagcttgccgcc
gccaaggccgggatgcctgtcgccgactactgcgccgagatgcacgaggtgcaaaccagg
ctctcggacggcttccgtctgtccttcgacaagttcggccgctcctcctcgccccagaac
catctgctgacccagcacttcgccggcaagctggccgagaacgggctgatctccgaggtg
tcggagaaacagatgtactcgaatgccgacggccgcttcctgcccgaccgctatatcgaa
ggcacctgccccaactgcggatacgaccgcgcgcggggcgaccagtgcgagaactgcacc
aagcagctcgacccgaccgacctgatcgagccacgctcggccatttccggttcgaccgac
ctcgaggtgcgcgagacgaagcacctctacctcaagcagcggtccctgcgcggccagttg
tcggagtggatcgactcgaagaccgactggcctgtcctgacgacttccatcgcgaggaaa
tggctcaacgacggcgacggcctccaggatcgcgggatcacccgcgacctcgactggggc
atcccggtgaagaaaggcgccgaggactggcccggcatggaaggcaaggtcttctacgtc
tggttcgacgcccccatcgaatacatcgcctgcgccaaggaatggtccgacgcgcgcggt
gcgcccgacgccgagtgggagcgctggtggcgcacggacaagggtgccgacgacgtccgc
tatgtccagttcatgggcaaggacaacgtcccgttccacacgctgtcgttcccggcgacg
atcatcggctctggagagccgtggaagctggtcgactacatcaagtcgttcaactacctc
aactacgacggcggccagttctcgacctcgcaggggcgtggcgtcttcatggaccaggcc
ctgtcgatcctgcccgccgactactggcgctggtggcttctgtcgcatgcgcccgagaat
tcggacgcggaattcacctgggagaatttccaggccagcgtgaacaaggatttggccgac
gtcctcggcaacttcgtcagccgcgtcaccaagttctgccgctcgaagttcggtgaggaa
gtcccgtcaggcggcgactggggcgccgaggaagacgccctcatcgcgcgcctatccgaa
ggcgtcgcgcgctacgaagcggcgatggaggcgatcgaggtccgcaaggccgcgggcgag
ttgcgcgcgatctgggtcgcgggcaacgaatacctccagtccgccgcaccctggtcggtc
ttcaaggacgaccccgaccgcgccgccgcgcaggtccgcctcgccctgaacctgatccgc
gtctacgcagtcctgtcggcgcccttcatccccgacgccgcagggtcgatgctttcggcg
atgaacacgctcgataccgactggccgtccgacatgcgcgccgcgctgaccgctctgccg
cccggccacgccttcaccgtgcccgaggtgctcttcaagaagatcgcggacgaagagcgc
gaagactggcagaccggctttgcggggcagcgctga

DBGET integrated database retrieval system