KEGG   Silicimonas algicola: EF888_09100Help
Entry
EF888_09100       CDS       T05779                                 

Definition
(GenBank) SDR family oxidoreductase
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
salo  Silicimonas algicola
Pathway
salo00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:salo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    EF888_09100
Enzymes [BR:salo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     EF888_09100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR DUF1776 THF_DHG_CYH_C AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: AZQ67271
UniProt: A0A316G7J8
Position
complement(1828479..1829285)
Genome map
AA seq 268 aa AA seqDB search
MSFSIAGKTAVVTGAANGVGLAIARHFVEKGARVMFADMDEERLQAELGSGTDEEDSVAW
FAGDLRQKLTLANLLSATLDRFDRVDILVNGSRKLLVGDPLDSDEDGFEATLQQNLLPTL
RVTQTFARRMIRQAEEDDDDAPAGSIINLSSIAARRTQPGLMAFSVTSAAIDQLTRSMAV
SLAPHRIRVNGIALGSVMTTGLQSSLKSQDDLRGRILAATPLNRIASASEVAEVAHFLAS
EASGFMTGRVLTVDGGRTLVDAADAPAH
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttctccatcgcgggcaagaccgccgtcgtcaccggcgcggccaacggggtcggc
ctcgccatcgcgcgccacttcgtcgagaagggcgcgcgcgtcatgtttgcggacatggac
gaggagaggcttcaggccgaactcggctccggcaccgacgaagaggacagcgtcgcctgg
tttgccggcgacctgcgccagaaactgacgctggccaatcttctgtcggcgacgctcgac
cgcttcgaccgtgtcgacatcctggtgaacggctcgcgcaagcttctggtcggcgatccg
ctggattccgacgaagacggcttcgaggcgacgctccagcagaacctcctgcccacgctt
cgcgtcacgcagaccttcgcgcgccggatgatccgccaggccgaggaggacgacgacgac
gcgcccgcgggctcgatcatcaacctgtcgtccatcgccgcgcgccggacccagcccggg
ctgatggccttttcggtgacctcggcggcgatcgaccaactcacccggtcgatggccgtg
tcgcttgccccgcaccgcatccgggtcaatggcatcgccctcggctcagtgatgaccacg
gggcttcagtcttcgctcaagtctcaggacgacctcaggggccggatcctcgcggcgacg
ccgctgaaccggatcgccagcgcctcggaagtggccgaggtcgcgcatttcctcgcctcc
gaggcctcgggcttcatgaccggccgcgtcctgaccgtggacggcggacgcaccctcgtc
gacgccgccgacgcccccgcgcactga

DBGET integrated database retrieval system