KEGG   Silicimonas algicola: EF888_09145Help
Entry
EF888_09145       CDS       T05779                                 

Gene name
metF
Definition
(GenBank) methylenetetrahydrofolate reductase [NAD(P)H]
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
salo  Silicimonas algicola
Pathway
salo00670  One carbon pool by folate
salo01100  Metabolic pathways
salo01120  Microbial metabolism in diverse environments
salo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:salo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    EF888_09145 (metF)
Enzymes [BR:salo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     EF888_09145 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: AZQ67278
UniProt: A0A316G803
Position
complement(1840406..1841269)
Genome map
AA seq 287 aa AA seqDB search
MTATVSYEFFPPRSVDASFRLWNAVTALKHTDPAFVSVTYGAGGTTRQLTHEAVEAITAH
TGLKVAAHLTCVDATREESLEIAHRYADAGVSHIVALRGDPPKGSQGFLPHPQGFDSSVD
LVRALADTGRFEITVGAYPDPHPEAGSGDADVEWLKRKVDAGATRAITQFFFEADTFFRF
RDRCVKAGIEAEILPGILPIQSWKGAHAFASRCGAHIPEKLVHGFETAERDGRTELYATA
VCTQLCDHLLQGGASHLHFYTLNDPHMTRDVVHALGLAPETALEKVA
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccactgtctcctacgagttcttcccgccacgctcggtggacgcgtcgttccgc
ctctggaacgccgtcaccgcgctgaagcacaccgatccggccttcgtgtccgtcacgtac
ggcgcgggcggcacgacgcggcaactgacgcacgaagcggtcgaggcgatcacggcgcac
accggcctgaaggtcgccgcgcacctgacctgtgtggacgctacgcgagaggaatcgctg
gagatcgcgcatcgttatgccgacgcgggcgtgtcccacatcgtggcgcttcgcggcgat
ccgccgaaaggctcgcaaggcttcctcccccatccgcagggcttcgacagctcggtcgac
ctcgtccgcgcgctggccgacaccgggcgtttcgagatcaccgtgggcgcctacccggac
ccgcaccccgaggcgggctcgggcgatgccgacgtcgagtggctgaagcgcaaggtggat
gcgggcgccacccgcgcgatcacccagttcttcttcgaggccgacaccttcttccgcttc
cgcgaccgctgcgtgaaggcggggatcgaggccgagatcctgccgggcatcctgccgatc
cagtcgtggaagggcgcgcacgccttcgcctcccgctgcggcgcgcatattcccgaaaag
ctcgtccacggcttcgagaccgccgaacgcgacgggcggaccgagctatacgcgaccgcc
gtctgcacccagctttgcgatcacctgctgcaaggcggcgcatcgcacctgcacttctac
acgctcaacgaccctcacatgacgcgcgacgtggttcacgcccttggcctggcgcccgag
accgcgctcgagaaggtggcctga

DBGET integrated database retrieval system