KEGG   Silicimonas algicola: EF888_18590Help
Entry
EF888_18590       CDS       T05779                                 

Definition
(GenBank) ADP-forming succinate--CoA ligase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
salo  Silicimonas algicola
Pathway
salo00020  Citrate cycle (TCA cycle)
salo00640  Propanoate metabolism
salo00660  C5-Branched dibasic acid metabolism
salo01100  Metabolic pathways
salo01110  Biosynthesis of secondary metabolites
salo01120  Microbial metabolism in diverse environments
salo01130  Biosynthesis of antibiotics
salo01200  Carbon metabolism
Module
salo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
salo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:salo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EF888_18590
   00640 Propanoate metabolism
    EF888_18590
   00660 C5-Branched dibasic acid metabolism
    EF888_18590
Enzymes [BR:salo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     EF888_18590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A LEDGF
Motif
Other DBs
NCBI-ProteinID: AZQ68959
Position
3763222..3764424
Genome map
AA seq 400 aa AA seqDB search
MNIHEYQAKGLLRAYGAPVAEGRVVLRGEEAKTQAGALDGPVWVVKAQIHAGGRGKGTFR
EADAGSKGGVRIAKSVEEAAEEAKRMLGRTLVTKQTGEAGKQVGRIYIEEGADIARELYL
ALLVDRASSRVAFVASTEGGMDIEEVAESTPGKILSFSVDPATGYQTFHGRRIAYALGLT
GAQVKQCVQLMGTLYRLFMDKDMEMLEINPLIVTTGGDLRCLDAKMGFDGNALYRHPDIT
ELRDTTEEDPKELEASKYDLNYIALDGEIGCMVNGAGLAMATMDIIKLEGAAPANFLDVG
GSATKERVTEAFKIITSDPNVKGILVNIFGGIMRCDVIAEGVVAAVKEVGLKVPLVVRLE
GTNVEEGKRIINESDVDVIAADDLKDGARKIVRAVKGEKA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
gtgaacatccacgaataccaggcgaaggggttgcttcgggcgtatggggcgcctgtggcg
gaggggcgtgtggtcctgcggggcgaggaagcgaagacgcaggcgggggccttggacggt
ccggtctgggtggtgaaggcgcagatccacgccggcgggcgtggcaagggcacgttcagg
gaggccgacgcggggtcgaagggcggcgtcaggatcgcgaagtcggtcgaggaggccgcc
gaggaagccaagcgcatgctcggccggacgctggtcaccaagcagaccggcgaggcgggc
aagcaggtcgggcgcatctacatcgaggaaggcgccgacatcgcgcgcgaactctacctc
gcgctgctcgtcgaccgcgcctcgagccgtgtggccttcgtggcctcgaccgaaggcggc
atggacatcgaggaggtggccgagagcacgcccgggaagatcctgtcgttcagcgtcgat
cccgcgaccggctaccagacgttccacggccgccgcatcgcctatgccctggggctcacg
ggcgcgcaggtcaagcagtgcgtccagctgatgggcacgctctaccggctcttcatggac
aaggacatggagatgctcgagatcaacccgctgatcgtgacgacgggcggcgacctgcgc
tgcctcgacgccaagatgggcttcgacggcaacgcgctctaccgccaccctgacatcacg
gaattgcgcgacaccaccgaggaggacccgaaggaactcgaggcctcgaagtacgacctg
aactacatcgccctcgacggcgagatcggctgcatggtgaacggcgccggcctcgcgatg
gcgaccatggacatcatcaagctcgagggtgctgcacccgcgaacttcctcgacgtcggc
ggcagtgccacgaaggagcgggtgaccgaggccttcaagatcatcacctccgatccgaac
gtgaagggcatcctcgtcaacatcttcggcggcatcatgcgctgcgacgtcatcgcggaa
ggcgtggtggcggcggtcaaggaggtggggctgaaggtcccgctcgtcgtgcggctcgag
ggcaccaacgtggaagaaggcaagcggatcatcaacgaatccgacgtggacgtcatcgcc
gccgacgacctcaaggacggcgcgcggaagatcgttagggccgtcaagggagagaaggca
tga

DBGET integrated database retrieval system