KEGG   Salvelinus alpinus (Arctic char): 111949364Help
Entry
111949364         CDS       T05762                                 

Definition
(RefSeq) uncharacterized protein LOC111949364
  KO
K05482  interleukin 18
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04060  Cytokine-cytokine receptor interaction
salp04621  NOD-like receptor signaling pathway
salp04623  Cytosolic DNA-sensing pathway
salp05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:salp00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111949364
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    111949364
   04623 Cytosolic DNA-sensing pathway
    111949364
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111949364
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:salp04052]
    111949364
Cytokines and growth factors [BR:salp04052]
 Cytokines
  Interleukins
   111949364
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 111949364
NCBI-ProteinID: XP_023822226
AA seq 204 aa AA seqDB search
MLDSEKMASSSEFKCVEFAVVDKEDIFFQVEHEDLESDDFKKENNKCFQKMIQIKNNRFL
VVDEEVLKFKERNKEQCKADDCRFNIQVYRNNDIDKXRGSAVILSVTSPCKQXYMVCCKN
GDQGVSAKPLEQPLPDQIGXSQHEAVFFMELIPGTSQYRFESSLWSRSYLSFEAGPDAEL
MKLVLREVPEDCVDENCSMRLLXC
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcttgattctgagaagatggcaagcagctccgaatttaagtgtgttgagtttgcggta
gtagacaaggaggacatcttttttcaagtcgaacatgaagatttagagtcggatgatttt
aaaaaggagaataataaatgcttccaaaaaatgatccaaatcaagaacaaccgattcctg
gttgtagatgaagaagttctcaagtttaaagagcggaataaggagcaatgcaaagcagat
gattgccggttcaatatccaagtatatagaaacaatgacattgacaagcmcagaggaagy
gctgttattctctcygtgacatcaccttgtaagcaarcttatatggtgtgctgcaagaat
ggggaccaaggagtttctgctaaaccactggagcaacctttgcctgaccaaattggcarc
tcacaacatgaggctgtgttcttcatggaactaattcctggtacatctcagtacagattt
gagtcatcgctgtggtctaggtcatacttgagctttgaggctggaccagatgcagagctc
atgaagttagttctcagggaggtgcctgaggattgtgtggatgagaactgtagtatgcgc
ttactgscatgttga

DBGET integrated database retrieval system