KEGG   Salvelinus alpinus (Arctic char): 111949772
Entry
111949772         CDS       T05762                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: MDS1 and EVI1 complex locus protein EVI1-like
  KO
K04462  ecotropic virus integration site 1 protein
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:salp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111949772
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:salp03000]
    111949772
Transcription factors [BR:salp03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    111949772
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_6 zf-H2C2_5 zf-C2H2_jaz zf-BED zf-C2H2_8 PyrI_C
Other DBs
NCBI-GeneID: 111949772
NCBI-ProteinID: XP_023822890
AA seq 1216 aa
MKAEDYSCDSMAPDMHEERQYRCEDCDQLFESVSELLDXQKVPCGTPPSAFLGNLEGTSE
KRVLSSPLLIGPLRPLSLRTTSMSLNLHPSTCLMMARDYKCDQCPKAFNWKSNLIRHQMS
HDSGSTTNVKTAQRCSRPSNLQRHIRSQQRGGAGSRLSDCGKTFATSSGLKQHKHIHSSV
KPFIFCKCQECVIYSHCFYSFYNREETDNNTHLSHDGPQECKECDQVFPDLQSLEAHSLS
HSEERDYKCDQCPKXFNWKSNLIRHQMSHDSGKHYECEKRTKQVFTDPSNLQRHIRSQHV
GARAHACPXCGKTFATSSGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRT
QIKCKDCGQMFSTTSSLNKHRRFCEGKNHFTAGGLFAHAQGMSLPGVPGAMDKAAMGGMG
HSSANLADYFGNRHHSGLTFPTAPGFPFSFPGLFSSGLYHRPPLIPATSPVRRPLGPGME
HIKSPLLSPSPGALEARELLKTLRKEALPGSEQPQGTEQRQSHGSSSKQRHSGGKMSSQS
ESSDLDDVSTPSGSDLDTTSGSELESDMESEGQRERAPRENGKGPKRKAGRGPQSPTTLI
SNHTKEFQGSPALFPPSLDEHTAVSGAVNDSIKAIASIAERYFGSTGLAGLQDKKVGALP
YPSMFPLPFFPTFSPPVYPFPERELRPPGLKGEPQSPPDEPSKKRQSRTSESPFDLTTKR
KQEEKVLAPFAPVSKSKPEASSRSTNQDQPLDLSMGGTRNRSSSHAPRGEESKKIHVFGE
DKAGMELPKTDTSLQHARPTPLFMDPIYRVEKRKMTDPFEALKDKYMRPAPGFLFHPQFR
MPVQNPVMSAIENMAEKLETFGSLNPESGDLMRSVPSMFDFRAPPTALPETLLRKGKERY
TCRYCGKLFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHIRNIHNKEKPFKCH
LCDRCFGQQTNLDRHLKKHENGNLSGTAASSPRSELDSSSAILDDKEDSYFNEIRNFIGN
TGQNQPSPDHSEEGLNGGPIEEEKPLVASHGSCDLEEGEELGAEEEEGEQSNNADGKPRD
EALPGNLDGDILHNEIEFEGPSDLELNCKTSPRRYEEEEDQSSYSALEHIRHFSDMHKME
DSEFSDGDGTSFGSPSLPEAVKQPLYRKSKSQAYAMILSLADKDALHPANHTPATMWHSL
ARAAAESSAIQSLSHV
NT seq 3651 nt   +upstreamnt  +downstreamnt
atgaaggcagaggattattcatgtgacagcatggctcctgatatgcacgaggagagacag
tatcgctgtgaggattgtgaccagctctttgagtctgtctctgagctgctggacnnacag
aaggttccatgtgggacacccccctcagccttcctggggaacctggaggggacaagtgag
aagcgcgtcctctcttcccccttgttgataggacccctcaggcccctcagcctcagaacc
acctctatgtcactcaacctgcacccctccacatgcctgatgatggctagggattacaag
tgtgaccagtgccccaaggccttcaactggaaatccaacctgattcgtcatcagatgtca
catgacagtggcagcactacgaatgtgaaaactgcacaaaggtgttcaagacccagtaac
ctgcagaggcacatccgctcgcagcaacgtgggggcgcgggctcacgcctgtccgattgc
gggaagacctttgccacgtcctctggcctgaaacagcacaagcacatccacagcagtgtc
aagcccttcatattctgtaaatgtcaggagtgtgtgatttacagccactgtttctactcg
ttctacaacagagaggaaacggataacaacacccacctcagccacgacggtccccaggag
tgtaaggagtgtgaccaggtgttccccgacctccagagtctggaagctcactctctgtct
cactcagaggagagggattacaagtgtgaccagtgccccaagngcttcaactggaaatcc
aacctgattcgtcatcagatgtcacatgacagtggcaagcactacgaatgtgaaaagcgc
acaaagcaggtgttcacagaccccagtaacctgcagaggcacatccgctcgcagcacgtg
ggggcgcgggctcacgcctgtccgnattgcgggaagacctttgccacgtcctctggcctg
aaacagcacaagcacatccacagcagtgtcaagcccttcatatgcgaggtgtgccacaag
tcttacacgcagttctccaacctgtgccgccacaagcgcatgcacgccgactgccgtacc
cagatcaagtgtaaagactgtggccagatgttcagcaccacctcctccctcaacaagcac
cggcgcttctgtgagggcaaaaaccatttcacggcaggggggttgttcgctcatgcccaa
ggcatgtccctccccggtgtccctggtgccatggacaaggccgctatgggtgggatgggg
cacagcagcgccaacctggcagactactttgggaaccggcaccacagcggcctgacattt
ccgaccgcccctggcttccccttcagcttcccgggtctgttctcctctggactgtaccac
cgaccccctctcatcccggccacctccccagtcagacggcccctaggtcccggtatggag
cacatcaagagccccctcctgtcgcctagccccggagccctggaggccagagaactgctc
aagaccctccgcaaggaggcattgcccggtagcgagcagccacaggggacagagcagcga
cagtcccatggctcctcctccaagcagaggcacagcggcggcaagatgagcagccaatcg
gagagcagcgatctggatgacgtaagcactcccagtgggagcgacctggataccacgtca
ggctcggagctggagagcgacatggaaagcgaaggccagcgggagagggcaccccgggag
aacgggaaagggcccaaaaggaaggcgggcagaggcccccagagccccaccaccctgatc
agtaaccacactaaggagttccaaggtagccccgccttgttcccgccctcgctggacgag
cacacggctgtctcaggggcggtcaatgactccatcaaggccatcgcctccatcgctgag
aggtactttggctccacggggctggcgggcctgcaggacaagaaggtaggcgccctgccc
tacccctccatgttccccctgcccttctttccaaccttctccccacccgtctaccccttc
ccagagagagagctcagacctccaggcctaaagggggagccccagtccccacctgacgaa
ccctccaagaagcgccagagcaggacctctgagtcgccctttgaccttaccacaaagcgc
aagcaggaggagaaggtcctcgcccccttcgcccccgtctccaaatccaaaccggaggcc
tcctcacgttccaccaatcaggaccagccgctggatctgagcatgggcggcaccaggaac
cgcagcagtagccacgccccccggggggaggaatcaaagaagatccacgtgtttggagaa
gacaaggcagggatggagctacctaaaactgacacctctctgcagcacgccaggcccacc
cccttgttcatggaccccatctacagggttgagaagaggaagatgaccgatccgtttgag
gctctgaaagacaagtacatgcggcccgcccccggcttcctcttccatccacagtttcgt
atgccagttcagaatcctgtgatgtcggccattgagaacatggcggagaagcttgagaca
tttggttcgcttaacccggagtcaggtgacctgatgcgctccgtcccctccatgtttgac
ttccgagctccgcccactgccctccccgagacgctactgcggaagggcaaggagcgctac
acctgcagatactgcggtaaactattcccacggtctgccaacctgacccgccacctaagg
acacacacaggagagcaaccgtacaggtgtaagtactgcgaccgctcgttcagcatctcc
tccaacctgcagcgccacatccgcaacatccacaacaaggagaagcccttcaagtgtcac
ctytgtgaccgctgcttcggccagcagaccaacctggaccgtcacctcaagaaacacgag
aacggtaacctctcaggcacggctgcgtcctcccctcggtcagagctggacagcagcagc
gccatcctggacgacaaagaggactcctacttcaacgaaatacgaaactttatcggcaac
acaggccagaaccagccgtcccctgaccattctgaggaaggattgaacggtggtcctatc
gaggaggagaagcccctggtggccagccatgggtcatgtgacctggaggagggggaggag
cttggcgccgaggaggaggaaggggagcagagcaacaacgctgacgggaaacctagggac
gaagctctccccggcaacctagatggtgacatcctacacaacgaaatagaatttgarggc
cctagcgatttggagcttaactgcaagacctccccaaggaggtatgaggaggaagaggat
cagagtagctactctgcgctggarcacatccgtcacttctctgacatgcataagatggag
gacagtgagttcagtgacggggacggcacctccttcggctcccccagcctgcctgaggcc
gtcaaacagcccctgtacaggaaatccaagtcccaggcgtacgccatgatactatctctg
gctgacaaggacgcactccacccagccaaccacacaccagccaccatgtggcacagcctg
gcacgggccgctgctgagtccagtgccatccagtccctcagccatgtatga

DBGET integrated database retrieval system