KEGG   Salvelinus alpinus (Arctic char): 111950238Help
Entry
111950238         CDS       T05762                                 

Definition
(RefSeq) rho-related GTP-binding protein RhoG isoform X1
  KO
K07863  Ras homolog gene family, member G
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:salp00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111950238
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:salp04147]
    111950238
   04031 GTP-binding proteins [BR:salp04031]
    111950238
Exosome [BR:salp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111950238
  Exosomal proteins of other body fluids (saliva and urine)
   111950238
  Exosomal proteins of colorectal cancer cells
   111950238
  Exosomal proteins of bladder cancer cells
   111950238
GTP-binding proteins [BR:salp04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    111950238
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf DUF3464 SR-25 AAA_7 Eapp_C AP3D1 Zip Connexin RNA_pol_Rpc4
Motif
Other DBs
NCBI-GeneID: 111950238
NCBI-ProteinID: XP_023823425
AA seq 252 aa AA seqDB search
MQQYEASSLPGNHTKEKKKKKKKKKEDKKKKEEDKKKKEEEEDEGASQISGTLVASVDEG
SMQTIKCVVVGDGAVGKTCLLISYTTNAFPEEYIPTVFDNYSAQISVDSRAISLNLWDTA
GQEEYDRLRTLSYPQTNVFIICFSIGSPSSHANVRHKWHPEVSHHCPGVPVLLVGTKKDL
RGDVEAVKKLKEHGLAPTNQQQGNALAKQIGAVKYLECSALMQDGVREVFEEAVRAVLYP
VTKKNVKKCAVL
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaatacgaagcgtctagtctgccgggaaaccacacgaaggagaagaagaagaag
aagaagaagaagaaggaggacaagaagaagaaggaggaggacaagaagaagaaggaggag
gaggaggatgagggcgcgagtcaaataagcggaaccctagtcgccagtgtggatgaggga
agcatgcagaccataaagtgtgtggtggtgggcgatggtgccgtkggtaagacttgcctt
ctaatctcctacacgacaaacgccttcccagaggagtacatccccaccgtgttcgacaac
tacagtgcccagataagtgtggacagccgcgccatcagcctcaacctgtgggacactgct
ggccaggaggagtacgaccgcctgcgcaccctctcctacccccagaccaatgtcttcatc
atctgtttctccattggcagcccgtcctctcatgccaatgtacggcacaagtggcaccca
gaggtatcccaccactgtcctggagttccagtgctgctggtgggcaccaagaaggatctg
cgtggagatgtggaggcggtgaagaagttgaaggagcacggcctggcccccaccaaccaa
cagcagggtaatgccttagccaagcagatcggcgccgtcaaatacctggagtgctcagct
ctgatgcaggacggtgtgagggaggtgtttgaagaggccgtgcgagctgtgctctacccc
gttaccaagaaaaatgtcaagaagtgtgctgtgttataa

KEGG   Salvelinus alpinus (Arctic char): 111950704Help
Entry
111950704         CDS       T05762                                 

Definition
(RefSeq) rho-related GTP-binding protein RhoG
  KO
K07863  Ras homolog gene family, member G
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:salp00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111950704
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:salp04147]
    111950704
   04031 GTP-binding proteins [BR:salp04031]
    111950704
Exosome [BR:salp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111950704
  Exosomal proteins of other body fluids (saliva and urine)
   111950704
  Exosomal proteins of colorectal cancer cells
   111950704
  Exosomal proteins of bladder cancer cells
   111950704
GTP-binding proteins [BR:salp04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    111950704
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf GTP_EFTU Gtr1_RagA
Motif
Other DBs
NCBI-GeneID: 111950704
NCBI-ProteinID: XP_023824277
AA seq 191 aa AA seqDB search
MQSIKCVVVGDGAVGKTCLLISYTTGAFPKEYIPTVFDNYSSQVTVDGRSISLNLWDTAG
QEEYDRLRTLSYPQTNIFIICFSISSPASYENVKLKWHPEVSHHCPGVPVLLVGTKSDLR
NDEETQRKLKEQSQSPVTHHQGAGLARQIQAARYLECSALNQDGIKEVFAEAVRAFLSPQ
HTTSKRSCRLL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcattaagtgtgtggtggtgggcgatggtgctgtagggaagacctgtctgctc
atctcctacacaaccggagccttccccaaggaatatatacccaccgtgtttgacaattat
agcagccaggtgacagtagacgggcgctccatcagtctgaacctgtgggacacggcgggt
caggaggagtacgaccgcctgaggaccctgtcctaccctcagaccaacatcttcatcatc
tgcttctccatctccagccccgcttcctatgagaacgtcaaactcaagtggcacccagag
gtgtcccaccactgccccggtgtgcctgtcctcctggtaggcactaagagtgacctgcgt
aacgacgaggagacccagcgcaagctgaaggagcagagccaatctcctgtcactcatcac
cagggggcgggactggcccgtcagatccaagccgcccgctacctggagtgttccgccctc
aaccaggatgggatcaaagaggtgttcgctgaggccgtccgagccttcctcagcccacag
cacaccaccagcaagaggtcctgtaggctactgtag

KEGG   Salvelinus alpinus (Arctic char): 111960787Help
Entry
111960787         CDS       T05762                                 

Definition
(RefSeq) rho-related GTP-binding protein RhoG
  KO
K07863  Ras homolog gene family, member G
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:salp00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111960787
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:salp04147]
    111960787
   04031 GTP-binding proteins [BR:salp04031]
    111960787
Exosome [BR:salp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111960787
  Exosomal proteins of other body fluids (saliva and urine)
   111960787
  Exosomal proteins of colorectal cancer cells
   111960787
  Exosomal proteins of bladder cancer cells
   111960787
GTP-binding proteins [BR:salp04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    111960787
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf GTP_EFTU Gtr1_RagA AAA_7
Motif
Other DBs
NCBI-GeneID: 111960787
NCBI-ProteinID: XP_023838759
AA seq 191 aa AA seqDB search
MQSIKCVVVGDGAVGKTCLLISYTTNAFPKEYIPTVFDNYSAQVTVDSRTISLNLWDTAG
QEEYDRLRTLSYPQTNVFVICFSVASPPSFENVKHKWHPEVTHHCPNTPILLVGTKKDLR
NDPEVLKKLKDQNQTTITQQQGTALARQIQAIKYLECSALNQDGIKEVFAEGVRAFLNPQ
PVATKKPCVLL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcatcaagtgtgtggtggtaggagacggtgcagtagggaagacctgcctactc
atctcctacaccaccaacgccttccccaaggagtacatccccactgtgtttgacaactac
agcgcccaagtgactgtggacagcaggactattagcctcaacctgtgggacacagcaggc
caggaggagtacgaccgcctgcgcaccctctcctaccctcagaccaacgtgtttgtcatc
tgcttctctgttgccagccccccctcctttgagaacgtcaagcacaagtggcacccggag
gtcacccaccactgtcccaatacgcccattctactggtgggcaccaagaaggacctgcgt
aatgacccggaggtgttgaagaagcttaaggatcagaaccagacaaccatcacccaacag
cagggcaccgccctggccaggcagatccaagccatcaagtaccttgaatgctctgccctc
aaccaagacggaatcaaagaggtgttcgctgagggtgtacgagcctttctcaacccacaa
cctgtcgccaccaagaaaccctgtgtgctattgtaa

KEGG   Salvelinus alpinus (Arctic char): 111967201Help
Entry
111967201         CDS       T05762                                 

Definition
(RefSeq) rho-related GTP-binding protein RhoG
  KO
K07863  Ras homolog gene family, member G
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:salp00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111967201
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:salp04147]
    111967201
   04031 GTP-binding proteins [BR:salp04031]
    111967201
Exosome [BR:salp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111967201
  Exosomal proteins of other body fluids (saliva and urine)
   111967201
  Exosomal proteins of colorectal cancer cells
   111967201
  Exosomal proteins of bladder cancer cells
   111967201
GTP-binding proteins [BR:salp04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    111967201
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf GTP_EFTU AAA_7
Motif
Other DBs
NCBI-GeneID: 111967201
NCBI-ProteinID: XP_023847837
AA seq 191 aa AA seqDB search
MQTMKCVVVGDGAVGKTCLLISYTTNAFPEEYIPTVFDNYSAQMTVDGRSISLNLWDTAG
QEEYDRLRTLSYPQSDVFVICFSIGSPSSHANVRHKWHPEVSHHCPSVPILLVGTKRDLR
NDGETVKKLKEQGLAPTTQQQGNSMAKQIGAVKYMECSALTQEGVREVFTEAVRAVLYPV
TKKNAKKCVLL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccatgaagtgtgtagtggtgggggatggtgccgtgggtaaaacatgtctcctc
atctcctacaccaccaacgctttcccrgaggagtacatccccaccgtgtttgacaactac
agcgcccagatgacggttgacggccgcagcatcagcctcaacctgtgggacacagccgga
caagaggagtacgaccgcctccgtactctctcatacccccaatccgacgtcttcgtcatc
tgtttctccatcgggagtccttcatcccacgccaacgtccgccacaagtggcacccggag
gtgtctcaccactgccccagcgtgcccatcctcctagtggggaccaagagggacttgagg
aatgatggggagactgtgaagaagctgaaggagcagggtttagctcccaccacacagcaa
caggggaacagcatggctaagcagataggagcggtgaagtacatggagtgttctgctctg
acgcaggaaggggtcagggaagtgttcaccgaggcagtacgggccgtgttgtatcccgtt
accaaaaagaatgccaagaagtgtgtactgttgtaa

KEGG   Salvelinus alpinus (Arctic char): 111980861Help
Entry
111980861         CDS       T05762                                 

Definition
(RefSeq) rho-related GTP-binding protein RhoG isoform X1
  KO
K07863  Ras homolog gene family, member G
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:salp00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111980861
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:salp04147]
    111980861
   04031 GTP-binding proteins [BR:salp04031]
    111980861
Exosome [BR:salp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111980861
  Exosomal proteins of other body fluids (saliva and urine)
   111980861
  Exosomal proteins of colorectal cancer cells
   111980861
  Exosomal proteins of bladder cancer cells
   111980861
GTP-binding proteins [BR:salp04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    111980861
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf GTP_EFTU AAA_7
Motif
Other DBs
NCBI-GeneID: 111980861
NCBI-ProteinID: XP_023867654
AA seq 220 aa AA seqDB search
MKYLLQQRKEEGASKKWWGTLVASVAEGSMQTIKCVVVGDGAVGKTCLLISYTTNAFPEE
YIPTVFDNYSAQISVDGRAISLNLWDTAGQEEYDRLRTLSYPQTNVFIICFSIGSPSSHA
NVRHKWHPEVSHHCPGVPVLLVGTKQDLRGDTEAVKKLKEHGLTPTTQQQGNALAKQIGA
VKYLECSALMQEGVREVFAEAVRAVLYPVTKKNDKKCVLL
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacttgttacaacaacgaaaggaggagggcgcgagcaagaagtggtggggcacc
ctagtcgccagtgtggctgagggaagcatgcagaccataaagtgtgtggtggtgggtgat
ggcgctgtgggtaagacttgcctgctcatctcctacacgaccaacgccttcccagaggag
tacatccccaccgtgttcgacaactacagcgcccagataagtgtggacggccgcgccatc
agcctcaacctgtgggacacggcaggccaggaggaatacgaccgactgcgcaccctctcc
tacccccagaccaacgtcttcatcatctgcttctccatcggcagcccctcctcccatgcc
aacgtacggcacaagtggcacccagaggtatcccaccactgccccggagttccagtgctg
ctggtgggcaccaagcaggatctgcgtggagatacggaggcggtaaagaagttgaaggag
cacggcctgacccccaccacccaacagcagggcaatgccttagccaagcagattggtgct
gtcaaatacctggagtgctcagctctgatgcaggaaggcgtgagggaggtgttcgcagag
gctgtgcgagctgtgctctaccccgttaccaagaagaatgacaagaagtgtgttctgtta
taa

KEGG   Salvelinus alpinus (Arctic char): 111982553Help
Entry
111982553         CDS       T05762                                 

Definition
(RefSeq) rho-related GTP-binding protein RhoG-like
  KO
K07863  Ras homolog gene family, member G
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:salp00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111982553
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:salp04147]
    111982553
   04031 GTP-binding proteins [BR:salp04031]
    111982553
Exosome [BR:salp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111982553
  Exosomal proteins of other body fluids (saliva and urine)
   111982553
  Exosomal proteins of colorectal cancer cells
   111982553
  Exosomal proteins of bladder cancer cells
   111982553
GTP-binding proteins [BR:salp04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    111982553
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf GTP_EFTU Gtr1_RagA AAA_7
Motif
Other DBs
NCBI-GeneID: 111982553
NCBI-ProteinID: XP_023869901
AA seq 191 aa AA seqDB search
MQSIKCVVVGDGAVGKTCLLISYTTNAFPKEYIPTVFDNYSAQVTVDSRTISLNLWDTAG
QEEYDRLRTLSYPQTNVFVICFSVASPPSFENIKHKWHPEVTHHCPNTPILLVGTKKDLR
NDPEVLKKLKDQNQTTITQQQGTALARQIQAIKYLECSALNQDGIKEVFAEGVRAFLNPQ
PVATKKPCVLL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcatcaagtgtgtggtggtaggagacggtgcagtggggaagacctgcctcctt
atctcctacaccaccaacgccttccccaaggagtacatccccactgtgtttgacaactac
agcgcccaggtgactgtggacagcaggactattagcctcaacctgtgggacacagcaggc
caggaggagtacgaccgcctgcgcaccctctcctacccccagaccaacgtgtttgtcatc
tgcttctctgttgccagccccccctcctttgagaacatcaagcacaagtggcacccagag
gtcacccaccactgtcccaatacgcccattctgctggtgggcaccaagaaggacctgcgt
aatgacccagaggtgttgaagaagcttaaggatcagaaccagacgaccatcacccaacag
cagggcaccgccctggccaggcagatccaagccatcaagtacctcgaatgctctgccctc
aaccaagatggaatcaaagaagtgtttgctgagggtgtgcgagcctttctcaacccacaa
cctgtcgccaccaagaagccctgtgtgctattgtaa

KEGG   Salvelinus alpinus (Arctic char): 112069172Help
Entry
112069172         CDS       T05762                                 

Definition
(RefSeq) rho-related GTP-binding protein RhoG-like
  KO
K07863  Ras homolog gene family, member G
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:salp00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112069172
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:salp04147]
    112069172
   04031 GTP-binding proteins [BR:salp04031]
    112069172
Exosome [BR:salp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112069172
  Exosomal proteins of other body fluids (saliva and urine)
   112069172
  Exosomal proteins of colorectal cancer cells
   112069172
  Exosomal proteins of bladder cancer cells
   112069172
GTP-binding proteins [BR:salp04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    112069172
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf AAA_7 Gtr1_RagA
Motif
Other DBs
NCBI-GeneID: 112069172
NCBI-ProteinID: XP_023992236
Position
Unknown
AA seq 191 aa AA seqDB search
MQNVKCVVVGDGAVGKTCLLISYTTNAFPEEYIPTVFDNYSAQMTVDGRIISLNLWDTAG
QEEYDRLRTLSYPQSNVFVICFSIGSPSSHANVRHKWHSEVSHHCPSVPILLVGTKSDLR
NDGETVKKLKEQGLAPITKQQGNSIAKQIGAMKYMECSALTQEGVREVFTEAVRAVLYPV
TKKNAKKCVLL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgcagaacgtaaagtgtgtagtggtgggggacggtgccgtgggtaaaacatgcctcctc
atctcctacaccaccaacgctttccctgaggagtacatccccaccgtgttcgacaactac
agcgcccagatgacggttgacggccgcatcatcagcctcaacctgtgggacacagccgga
caagaggagtacgaccgcctccgtactctctcatacccccaatccaacgtcttcgtcatc
tgtttctccatcgggagtccttcatcccacgccaacgtccgccacaagtggcactcggag
gtgtctcaccactgccccagcgtgcccatcctcctagtggggaccaagagtgacctgagg
aatgatggggagacggtgaagaagctgaaggagcagggtttagctcccatcacaaagcaa
caggggaacagcatcgctaagcagataggagcgatgaagtacatggagtgttccgctctg
acgcaggaaggggtcagggaagtgttcaccgaggcagtacgggccgtgttgtatcccgtt
accaaaaagaatgcaaagaagtgtgtactgttgtaa

DBGET integrated database retrieval system