KEGG   Salvelinus alpinus (Arctic char): 111951202
Entry
111951202         CDS       T05762                                 

Gene name
tm7sf2
Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp00100  Steroid biosynthesis
salp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:salp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    111951202 (tm7sf2)
Enzymes [BR:salp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     111951202 (tm7sf2)
SSDB
Motif
Pfam: ERG4_ERG24 PEMT DUF1295 ICMT
Other DBs
NCBI-GeneID: 111951202
NCBI-ProteinID: XP_023825037
AA seq 420 aa
MKFNKQKSPQAEKEFGGTLGATCIPVFLPLTVLYLLCVCRSPVASVLQWPPVLPPTAQLW
DPLAPVLILGWMALQSFFYLLPMGKVSEGMVLKDGSRLKYPINGFHALCITAVLLTLSLW
LGMPLGYLFELLLPLAVCAIGVSFILSLYLYICSFWAPHHALAQGGNTGNPLYDFFMGRE
LNPRIGSFDLKYFCELRPGLIGWVVINFGMLMKEVELRDSASLAMILVNSFQLLYVADAL
WNEEAVLTTMDIVHDGFGFMLVFGDLAWVPFTYSLQAAFLVVHPQSLSLLGATAIVTLNG
AGYYIFRKSNSQKNQFRRDPTXPSVANLETIATATGKRLLVSGWWGLVRHPNYLGDLLMA
LAWSLPCGFNHLLPYFYVVYFTVLLIHREARDERHCRAKYGLAWDSYCRRVPYRIFPYIY
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgaagttcaacaaacaaaaatccccacaagcagaaaaggaatttggggggactttgggt
gccacctgtatccctgtcttcttgcccctgacggtactttacctgctctgtgtatgtcgc
tcccctgtggccagcgtgctccagtggccccctgtcctgccccccacagcccagctatgg
gaccccctggcccctgttctcatactgggctggatggcccttcagagcttcttttacctg
ctgcctatggggaaggtgtctgaggggatggtgctaaaagatggctcgagactcaagtac
cccataaacggttttcatgccctttgcatcacagctgttctgttgacattgtcactatgg
ctggggatgcctctggggtatctctttgagctgttgttgcccctggcagtgtgtgctatt
ggggtgtcattcatcctctccctctacctctacatatgctccttctgggcccctcaccat
gccctcgcccaggggggaaacacaggaaaccccctgtatgatttctttatgggacgagag
ctgaacccacggattggaagctttgatctgaaatatttttgtgagctgagaccaggtctg
attggctgggtggtgattaactttgggatgctaatgaaagaggtggagctacgggactct
gcctccctggccatgatactggtcaacagcttccagctgctctacgtggcggatgctctg
tggaatgaggaggctgtgctgaccaccatggacatagtgcatgatggctttgggtttatg
ttggtctttggggacctggcctgggttccctttacgtacagcctgcaagctgccttcctg
gtcgtgcacccacagtccctcagtcttctaggagccacagctatagtcacattgaatggt
gctgggtattatatcttcagaaaatcaaactcccagaagaaccaattcagacgggaccct
acgsatcccagtgttgcaaacctggagactattgccacagcaactgggaagcgccttttg
gtgtctggctggtggggcctcgtacgccatcctaactacctaggagaccttctcatggcc
ctggcatggtctctgccgtgtggattcaaccatcttctaccttacttttatgttgtgtac
ttcactgtcctgttgattcaccgagaggcccgtgacgagaggcactgcagggccaagtat
ggcctggcatgggacagctactgcaggcgcgtgccctacaggatcttcccctatatctac
tga

DBGET integrated database retrieval system