KEGG   Salvelinus alpinus (Arctic char): 111951359Help
Entry
111951359         CDS       T05762                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type 1D-like
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:salp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    111951359
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:salp01001]
    111951359
Enzymes [BR:salp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     111951359
Protein kinases [BR:salp01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   111951359
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Kdo Tyrosinase Nucleo_P87 FTA2
Motif
Other DBs
NCBI-GeneID: 111951359
NCBI-ProteinID: XP_023825183
AA seq 447 aa AA seqDB search
MDRENGESGKGTWKKQVDDIKKIFELKEILGTGAFSEVVLAQERSTGKMFAVKCIPKKAL
KGKESSIENEINVLRKFPPDVCLRVCTSVLLTSFTDPLSVCVYRVSGGELFDRIVEKGFY
TEKDASTLIRQVLDAVEYLHKLGIVHRDLKPENLLYFNPQDESKIMISDFGLSKMEGSGD
VMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKA
DYEFDAPYWDDISDSAKDFIGSLMEKDPAKRFTCDQALRHPWIAGDTALCKNIHESVSRQ
IRKNFAKSKWRQAFNATAVVRHMRRLQLSSSMGHSMDSSHPHPPNSRAAQMQNQXNQANQ
NXAXQTPNQTPSQSSTQPSPSPSQTRSQNPNAAIMKSFSVDSPHKDCAPATPTPCSLATA
ASSSPSGGTELTRPHPSTVATVLTETK
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggatcgggagaatggagagtccgggaaagggacgtggaaaaagcaagtcgacgatatc
aagaaaatatttgaattgaaagagatcctcggaaccggggcattctctgaggtggtgttg
gcccaggagaggtctacagggaagatgtttgctgtgaagtgtatccccaagaaggccctg
aaggggaaagagagcagcatcgagaacgagatcaacgtgctccgcaagttccctccagat
gtgtgtctgcgtgtgtgcacatctgttttacttacctcgtttactgaccccctctctgtc
tgtgtctacagagtgtcgggaggtgagttgtttgaccgtatcgtggagaaggggttctac
acagagaaagatgccagtacgctcatcagacaggtgctagacgctgtcgaatacctccac
aagttgggcatcgtccacagagacctgaagccagagaacctgctgtattttaacccccag
gacgagtctaagatcatgatcagtgactttggtctgtccaagatggagggcagcggggac
gtcatgtcgaccgcgtgcggcacgccgggatacgtggctccagaagttcttgctcagaag
ccctacagtaaggcagtggactgctggtccatcggagtcattgcatacatcctgttgtgt
ggctatcctccattctatgatgaaaatgactccaagctctttgagcagatcctcaaagca
gactacgagtttgacgcaccgtactgggacgacatatctgattcagccaaagactttatc
ggcagtctgatggagaaagacccggcgaagcgcttcacctgtgaccaggccctcagacac
ccatggatcgctggggacacagccctctgcaagaacatccacgagtctgtgagcagacag
atcagaaaaaactttgctaagagcaaatggaggcaagccttcaatgccactgcagtggtg
cgacacatgaggagactgcagttgagcagcagtatgggccacagcatggacagctctcac
cctcaccctcctaacagccgggccgcacagatgcagaaccaakggaaccaggccaaccag
aaccwggccayccagacmcccaaccagacccctagccagagctctactcaaccctctccg
agtccaagccagactcggagccagaaccctaatgcagccattatgaagagcttttctgtg
gactcacctcacaaggactgtgccccagctactcccaccccctgcagcctggcaactgca
gcctcctcttccccctccggggggacggagctcacccggccccacccctctactgttgcc
acagtactaacagagactaagtga

DBGET integrated database retrieval system