KEGG   Salvelinus alpinus (Arctic char): 111951624Help
Entry
111951624         CDS       T05762                                 

Definition
(RefSeq) sphingosine kinase 1-like
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp00600  Sphingolipid metabolism
salp01100  Metabolic pathways
salp04020  Calcium signaling pathway
salp04370  VEGF signaling pathway
salp04371  Apelin signaling pathway
Module
salp_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:salp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    111951624
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    111951624
   04371 Apelin signaling pathway
    111951624
   04020 Calcium signaling pathway
    111951624
Enzymes [BR:salp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     111951624
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 111951624
NCBI-ProteinID: XP_023825625
AA seq 567 aa AA seqDB search
MDPKITESDPPSYRNGITQVLQYGEFTATGNRKVRYAVSLTERDLTIQKITSTPAGRSKV
VFNLRDCVGCRAFSADDNADAYFSVYFYPFKRRWMSSGVARQRVEQCFRVALFQDPRANL
EEAEKWAGTIRESSVRQQHLRNRVLYSEVHRPCSVMLLVNPHSGKGQALSLFTGHVQHML
NEAGVPHTLVITERQNHARELVREADLSQWGALVIMSGDGLLFEVVNGLMEREDWEEAIQ
TPLGILPGGSGNALAASIHHYSGAQPVSSEELLVSCGFLLCKGLVSRMDLASVHLGSSPS
NPTRLFSFLSLAWGFVADVDVESEKYRHVGAARFTMGTLVRLASLRVYKGRLAYLPVDEV
DGEXEDRQSAVSLEEMTSVSPQCQPPSSAFCSSTLLCRPSKDSPCQNAAHNSRNSNNSYK
AKNWEPMSANATLTGPPDSLLVPLDQPVPSDWVVVXEEDFVLMLAMYQSHLAKDLYAAPD
STLDDGLIHLIYVRAGISRTALLRLFLAMEKGTHLANNCPHLVYTRVRALRLEPYSPKGV
ITVDGEVVEYGPVQAQVHGGIARLITR
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggacccgaagataaccgaatcggaccctccatcatatcgcaacggaatcacccaggtt
ctgcagtacggggaattcacagccactggcaaccgaaaggtgaggtacgcggtgagttta
accgagagagacctcaccattcagaagatcacgtcgacacctgcgggacggagcaaggtg
gttttcaacttgagggactgtgtcggctgccgggctttcagcgcagatgacaacgcggac
gcgtacttctctgtctatttctacccttttaaaagacgatggatgagctctggagtggcc
aggcagcgggtcgagcagtgttttcgggtagccctgttccaggacccacgcgccaaccta
gaggaggcagagaaatgggctggcaccatccgggagagctctgttcgtcaacaacatttg
agaaatcgtgtgctttacagtgaggtgcaccgtccctgcagcgtcatgctactggtgaac
ccccacagtgggaagggccaggccctcagcctcttcaccggacacgtccaacacatgctc
aacgaggccggtgtcccacacactctggtcatcactgagcggcagaaccatgccagggag
ttggtgagagaggctgacctgtcacagtggggtgctctagtcatcatgtccggggacgga
ctgctgtttgaggttgtgaatggcctgatggagagagaggactgggaggaggccattcag
accccactgggcatcctaccagggggctctggtaacgccctggctgcttctatacaccac
tactctggggcccagccggtgtcaagcgaggagctgctggtcagctgtggcttcctgctg
tgtaagggcctggtgtctcgcatggacctggcgtccgtccacctgggctccagcccctcc
aaccccacgcgcctcttctccttcctctcgctggcctggggcttcgtggctgacgtggac
gtggagagcgagaagtaccgccacgtgggcgccgcccgcttcaccatggggacgttggtc
aggttggcatctttgagggtgtataagggccgtctggcatacctgccggttgacgaggtg
gatggagagraggargatcgtcaatcggcagtctcgytggaggagatgactagcgtgtca
cctcaatgccaaccgccatcgtctgcattctgctcctccaccctcctctgccgaccttcg
aaggactcgccgtgccagaacgcagcccacaactcccgtaactcaaacaattcctacaag
gcgaagaattgggaacccatgtccgctaatgccaccctaacaggcccgccagactctctc
ctggtgcccctggaccagccggtgcccagcgactgggtggtggtgsccgaggaggacttt
gtcctcatgctggccatgtaccagtctcacctggcaaaggacctgtatgccgcrcccgac
tctacacttgatgacggcctcatccacctgatatacgtmcgagcaggcatwtcgcgcacg
gccctgctccggctcttcctggccatggagaagggcacccacctggccaacaactgcccc
cacctggtgtacacccgggtgcgggcgctgcggctggagccctactcgccaaaaggggtg
atcacggtggacggggaggtggtggagtatgggccggtccaggcccaggtacacggcggg
atagccaggctcatcactagatga

DBGET integrated database retrieval system