KEGG   Salvelinus alpinus (Arctic char): 111952465
Entry
111952465         CDS       T05762                                 

Definition
(RefSeq) adenylate cyclase type 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp00230  Purine metabolism
salp01100  Metabolic pathways
salp04020  Calcium signaling pathway
salp04114  Oocyte meiosis
salp04261  Adrenergic signaling in cardiomyocytes
salp04270  Vascular smooth muscle contraction
salp04371  Apelin signaling pathway
salp04540  Gap junction
salp04912  GnRH signaling pathway
salp04914  Progesterone-mediated oocyte maturation
salp04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:salp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111952465
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111952465
   04020 Calcium signaling pathway
    111952465
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111952465
  09144 Cellular community - eukaryotes
   04540 Gap junction
    111952465
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    111952465
   04914 Progesterone-mediated oocyte maturation
    111952465
   04916 Melanogenesis
    111952465
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111952465
   04270 Vascular smooth muscle contraction
    111952465
Enzymes [BR:salp01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     111952465
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 CENP-T_C
Other DBs
NCBI-GeneID: 111952465
NCBI-ProteinID: XP_023826919
AA seq 1328 aa
MQDDPEGYLVIGGNRTGDIHRTGSGFXGGGDGGDRGDGQDTSMELKDLTSSTTDNEHPIA
EEDEGGDIITQRKDXTAKMNDIRTQCDDFGDEVNGDSESQSANSEPRVYIEVGVAKVELA
SEPLKAQSSFQESPEFPSTASTGNHGTDIKTDXLMNDSTKSSNDSDNDSAKTTTDTYDNL
DDSGKVNGEDSSDKKSTDAFKLKTNPHNHNSDLAMMDSTTTLCRRNHDNYTTPDIPSDDT
STSRSETSVPLNQSAPAPDITWDDTPNVREGGEGDGRPPSQRSVAEGVCCCYRAVHKAFI
RCLEETPAMLPGLLLAMGFCVAIIILIPTTGRLKENISVHVGALSVVCVVLCLSTALLVA
LPWLAVVRRCGGALSLCLWGALYVTAIVFTFTGGPVTAWEQVAFFLFLSLCVYTVLPLSL
AWALMVGIGTSVSHIIIISVYVPVTRPNTPDLAWQGKELVANAVLFLCVNCVGVFHRWLT
EHAHRKSSKKKERFSAMRSQRDMQKHQQEHLLLSVLPRYIAMELKTEIIKRLSENKEKGQ
NFHSLYIRQHKDVSILYADIVGFTKLASTCSPEELVGVLNKLFGRFDDIAKKNECLRIKI
LGDCYYCVSGLPDPIPAHARNCVQMGLDMCTAINKLREATGVEISMRVGVHSGNVLCGVI
GLQKWQYDVWSHDVTLANHMESGGMPGRVHITEETLGHLAGAYQVDDTDGRSWDSLLKGR
KTYLVIDPHKEDTTSKRKEKTNILTVSGHKQRASVRMSQYLQSWQTICPFSDLSNPEATP
TQLPINPTCASTNQSQPSADRPPTQTDSSSTSPVLDDGIKGSLDTIDAAGRREKKLNCIT
LLFNDLKLEKQFRLSEVKGLHQSVGCMALIFVSLFTVQMLVSQKNFHMAVSYGVTFPVLV
LLLSVVCTGYLKVWRSKIPLSLQWVTSLSQGVATRPAARLLLVCLCLLITLLMAILNFFF
LPGNDCTSNSYNTSQLQNLNLYTVPYYLYCCLLAMLSVVVFVRTCMSIKVLLLTLAVVVY
LSLFLYVYAPRSDCYMALLYNDTKPGVLKEPKIMAGVWLFVFYFTCLILARQDELGCRVE
FLLQQCFRTERVEMETMENVNKLLLKNVLPLHVASKFMGKTIRNQDLYSQSCDCVCVMFA
SVPQFKEFYSESSVNRDGLECLRFLNEIISDFDELLSKPKFCSVEKIKTIGSTYMAAAGL
TNPAIGDERKDCDVSYSHVRSMVEFAIALKNNLESINQHSFNSFKLRIGINHGPVIAGVI
GAHKPQYDIWGNSVNVASRMDSTGVLDKIQVTEETAQVVKTFGFSVTKRGVITVKGKGEL
TTYFINTD
NT seq 3987 nt   +upstreamnt  +downstreamnt
atgcaggacgaccctgagggatacttggtgattgggggaaacagaacgggagacatccac
aggactggtagtgggtttmctggtgggggagatgggggagacaggggagatgggcaagac
acaagcatggagctgaaggatttgaccagcagcacaacagacaatgaacatccgattgca
gaagaagatgagggcggtgacatcataacycaaaggaaggacytcacagcaaaaatgaat
gacatcaggactcaatgtgatgacttcggagatgaggtcaacggtgattccgagagccaa
tcagcgaacagtgagcctcgggtctacatagaggtgggcgtggctaaggtggagctagcc
tcggaaccactcaaggcccaatcgtctttccaagaatctccggagttcccgtccactgcg
agcactggtaaccatggcactgacattaaaacagacartttgatgaatgacagcacaaaa
tccagcaatgactctgataatgatagcgctaaaacgaccactgacacttatgataactta
gatgatagcggcaaagtcaacggtgaagattcttcggacaaaaagagtactgatgccttt
aaattaaaaacaaacccacacaatcacaactctgatctggccatgatggactccacaaca
accctctgcagacgtaaccacgacaactacacaacccccgacatcccgtccgacgacact
tccacctccagatcggaaacttcagtccctctcaaccaatcggcccctgcgcccgacatc
acatgggacgacaccccgaacgtcagggaggggggtgaaggcgacggtagaccgccctca
cagaggagtgtagcagagggggtgtgctgctgctacagagcagtacacaaggccttcata
aggtgcctagaggagacaccagccatgctccctggactgttgctggccatgggcttctgt
gtggctatcatcatccttataccaactaccggaaggctgaaagagaacatcagtgtccat
gtaggggccctgtccgtggtctgtgtggtgctgtgtttgagcacagccctgctggtggcc
ctgccctggctggccgtggtgaggcggtgtgggggagcgctgtcactttgcctctggggg
gccctgtatgtcacagctatagtcttcaccttcaccggagggcccgtcaccgcatgggaa
caggtagcgttcttcctcttcctgtctctgtgtgtgtacacggtgctgcccctgtcccta
gcctgggctctgatggtgggcatagggaccagtgtgtcacacatcatcatcatcagtgtc
tacgttcccgtcaccaggcctaacacaccagacctggcatggcagggaaaagaactggtg
gccaatgccgtgttgtttttgtgtgtgaactgtgtgggagtgtttcaccggtggctgact
gagcatgcccacaggaagtccagtaagaagaaagagaggttcagcgccatgcgctcccag
agggacatgcagaaacaccagcaggagcacctcctcctgtctgtgttgccacggtatatc
gccatggagctgaagacggagatcatcaaacgactgtcggagaataaagagaaaggacag
aactttcacagtctgtacatccggcaacacaaagatgtcagtattctgtatgctgacatt
gtggggtttactaagctggccagtacctgttctcctgaggagctggtgggagtcctcaat
aagctcttcggcaggttcgatgacattgccaagaagaacgagtgtttgcgcataaagatc
ctgggtgattgttactattgtgtgtcgggtctgccagaccccatcccagcccacgccagg
aactgtgttcagatgggactcgacatgtgcacggctatcaataaactacgggaggctacw
ggtgtggagatcagtatgagagtgggtgtgcactctggcaacgttctctgtggcgtgatt
ggtctacagaagtggcagtacgacgtctggtcacatgacgtgaccctggccaaccatatg
gagtctgggggaatgccagggcgtgtccacatcacagaggagacactgggtcacttagct
ggggcataccaagtggacgacactgacgggaggagctgggactctctgctaaaggggagg
aaaacctatctggtgatcgacccccataaggaagacaccacctctaagaggaaggaaaag
acaaacatcctgacggtcagtggtcataagcagcgagcctcagtgaggatgtctcagtac
ctgcagtcctggcagaccatctgtccattctctgacctcagcaaccctgaggccacaccc
acccagctgccaatcaacccgacctgcgccagcacgaaccaatcacagccatccgcagat
agaccccctactcagaccgattccagcagtaccagtccggtcctggacgatggcataaaa
gggtcgttagatactattgacgctgcagggcggagagaaaagaagctgaactgcatcacg
ctgttattcaatgacctaaagctggagaaacagtttcgtctctcagaggtcaaaggtcta
caccagtcagtaggctgcatggctctcatcttcgtgtctctgtttactgtccaaatgctc
gtctcccagaaaaactttcacatggctgtgtcgtatggtgtcaccttccctgttctagtg
ttgcttctctctgtggtctgcactggatacctcaaggtatggcgctctaaaatccctctc
agtctacagtgggtgacgtcgctgtcgcaaggagtggccacaaggccggcggcacgttta
ctgctggtctgcctttgtctactcatcaccttgcttatggccatactgaactttttcttt
ctacctggaaacgactgtacctccaactcgtacaacacatcgcaactacagaacctcaac
ctgtacaccgtcccttattacctgtactgctgcctgctggctatgctaagtgtggtggtg
tttgtgaggacgtgcatgtccatcaaggtgttgctcctcacactggctgtagtagtctac
ctgtctctcttcctctacgtctacgcacctcgctcagactgttacatggccctgctctac
aacgatacaaagccaggagtcctaaaggagcctaagatcatggctggagtttggctgttc
gtcttctattttacatgcctgatactggcacgacaggacgagttgggctgtcgcgtggag
ttcctactgcagcagtgtttcagaactgagagggttgagatggagaccatggagaatgtt
aacaaactactactgaagaatgtcctacctcttcatgtagcatctaaattcatgggcaag
accatacgcaaccaggacctgtacagccagtcatgtgactgtgtgtgtgtgatgttcgcc
tcggtaccccagtttaaggagttctacagcgagagcagtgtgaaccgagatggactggag
tgtttacgtttcctcaatgagatcatctcagactttgacgagcttctctctaagccaaag
ttctgttctgtggagaagattaagactattggcagcacctacatggcagctgctggtctg
accaatcctgctataggggacgagcgaaaggactgtgatgtgtcctacagccatgtacgc
agcatggtagagtttgccatcgctctgaagaacaacttggagtccatcaaccaacactcc
ttcaacagctttaagctacgcatcgggataaaccatggtccagtgattgcgggggtgatc
ggagcccacaaaccacagtatgatatctgggggaactctgtgaacgtggccagtaggatg
gacagcaccggagtactagacaagatccaggtgaccgaggaaacagcgcaggtggtaaag
acctttggcttcagtgtgaccaagagaggagtcatcaccgtcaagggcaagggagaactt
acgacctacttcatcaacaccgactga

DBGET integrated database retrieval system