KEGG   Salvelinus alpinus (Arctic char): 111952775
Entry
111952775         CDS       T05762                                 

Gene name
ankrd53
Definition
(RefSeq) ankyrin repeat domain-containing protein 53 isoform X1
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
salp  Salvelinus alpinus (Arctic char)
Brite
KEGG Orthology (KO) [BR:salp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:salp03036]
    111952775 (ankrd53)
Chromosome and associated proteins [BR:salp03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    111952775 (ankrd53)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank_4 Ank Ank_3
Other DBs
NCBI-GeneID: 111952775
NCBI-ProteinID: XP_023827450
AA seq 445 aa
MGYNSKVCLYSWIGTLTMRMFSINSLLQGQLLNSGKINKPRVGGGVVLVRRLVKAPPDSD
MFQAATSGDRDWLRLSLKRALSPTQLDKQGLTVLHVAGLHGQLECMKLLLASQVVDINAS
CPLGRRPIHMVLTAKSRPHSHACLTYLLEHGALPNVATDTGLTPLHLAATEGLWECTKTL
VQVGADTGAQDNRGHTPLELARIWCHRRIARFLKDSMWQNEKKREMERRKALQNLQQDLF
NMHRRAENIEKLGRQNLMEEKVTAWADKKGLPLLWAQPRATWNQAHAHCLSPDQRPQSQR
TKACHRQCPGAPPREAWNISPNPSKPPPASVSRPQGVRLSSQPERSPPEPDLRRSVTLCR
ARGDGRPQYTTKWDGSPQSVPNLPWDVLQRGLFSAAFPSRIASPNHFQPNHVLDLPRLGC
SPGPNTSPWTEVAMHLAEELEPGHY
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgggctataactcgaaagtatgtctatattcttggattggaacattaacaatgcgcatg
ttttcaattaattctcttttacaaggacaacttctgaattctggaaaaataaataagccc
agggtaggtggtggggtggtgctggttcggcggttggtgaaggctccgccggacagcgac
atgttccaggcggccacctcgggggaccgtgactggctgcgactcagcctgaagcgggcg
ctatccccaacgcagctcgacaaacagggtctgacagtgctccacgtggccggcctacat
gggcagttggagtgtatgaagctgctgttggcatcccaagtggtggacataaacgccagc
tgccccctgggccgcagacccatccacatggtcctcactgccaagagcagaccccactcc
catgcctgcctcacctacctactggagcatggagccctgccaaacgtagccactgacaca
gggttgacgcccctccacctggctgccaccgagggcctgtgggagtgtaccaagactcta
gtgcaggtgggggcagacactggtgcacaagacaacagaggacacacacctctggaactg
gcacgcatctggtgtcacagaaggatcgccaggtttctgaaggactctatgtggcagaac
gagaagaaaagagagatggagaggcgcaaggcgctgcagaaccttcagcaggacctgttc
aacatgcacaggagggccgagaacatagagaagctggggagacagaacttgatggaagag
aaggtcacggcgtgggccgataagaaaggccttcccctcctctgggcccagcctagggcc
acgtggaaccaggctcacgcccactgcctctccccagaccagaggccacaaagccagagg
accaaggcctgccacaggcagtgtccaggggccccgcctcgggaggcctggaacatctcc
cccaacccctccaaacccccaccggcctctgtctcccggccccagggggtgcgtctgagc
agccagcccgagaggtcccctccagagcccgacctgaggcgcagcgtaactctctgcagg
gcccgtggggatggacgtccccagtacactaccaagtgggacgggtccccccagtcggtc
cccaacctgccctgggatgtccttcagagggggctgttttctgctgccttcccatcaagg
atcgcctcgcccaaccacttccagcccaaccatgtgctggacctgccgcgcctcggctgc
tccccaggacccaacacctctccctggacagaggtggccatgcacttggccgaggagctg
gagcctggccactactga

DBGET integrated database retrieval system