KEGG   Salvelinus alpinus (Arctic char): 111954418Help
Entry
111954418         CDS       T05762                                 

Definition
(RefSeq) probable palmitoyltransferase ZDHHC14
  KO
K16675  palmitoyltransferase ZDHHC9/14/18 [EC:2.3.1.225]
Organism
salp  Salvelinus alpinus (Arctic char)
Brite
Enzymes [BR:salp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     111954418
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 111954418
NCBI-ProteinID: XP_023829924
AA seq 496 aa AA seqDB search
MHLGLDEPVRECQYNPICTRNSSSMETSGHKKKRTPRRKWQIFPGRNRFYCNGRVMMARQ
TGVFYLTLVLIMVTSGLFFAFDCPFLASNLTPAIPVIGGVLFVFVLGMLFRASFSDPGVL
PRATPDEAADLERQIDAANGPSGPGYRPPPRIREVVINGQTVKLKYCFTCKIFRPPRASH
CSLCDNCVERFDHHCPWVGNCVGKRNYRFFYLFILSLSFLTVFIFAFVITHVILRSNRTG
FLSALKDSPASVLEVLVCFFSVWSIMGLSGFHTYLISSNQTTNEDIKGSWSTKRAKDNYN
PYSYGNILTNCCAALCGPLPPSLIDRRGLIQSDTPQPVSHSNGSSMYNSTQLHTHMCDQE
HCIQSTKFVLQAAATPLLHSDPVMMGGEGPTLPGKSSLGGPCASLAPSQPSLPSSMPGLG
CAGDMLTLRDPDTHCHHHHFVSPEETPSPGPMPLTLPCPAHMTHGGHMNPAQLYDPASQD
SLHEDSVRGLVKLSSV
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgcatctcggacttgatgagccggtgcgagaatgtcagtataacccgatctgcacgcgc
aactcatcgtctatggagacctcggggcacaaaaagaagaggactccccgcaggaagtgg
cagatcttccctggccgaaatagattctactgtaatggaagggtcatgatggcgagacag
accggggtcttctacctaaccctggtcctcatcatggtcaccagcgggcttttcttcgca
ttcgactgcccgttcctggcgtccaacctgaccccggccatcccggtgatcggaggggtg
ctgtttgtctttgttctggggatgctgttcagagccagcttcagtgacccgggagtcctg
ccccgtgccacacccgacgaggctgccgacctggagagacagattgacgccgctaatggc
cccagtggtccagggtacaggccgcccccgaggatcagagaggtggtcatcaacgggcag
acggtcaagcttaagtactgtttcacctgcaagatcttcaggcccccacgggcctcgcac
tgcagcctgtgtgacaactgtgtcgagcgttttgaccaccactgtccctgggtggggaac
tgtgttgggaagaggaactatcgtttcttctacctcttcatcctgtccctctccttcctc
accgtcttcatcttcgccttcgttattacacacgtcatcctgagatccaaccggacaggc
ttcctcagcgcactcaaagacagccctgccagtgtgctggaggtgctggtgtgtttcttc
tcggtgtggtccattatgggcctgtcgggcttccacacctacctcatcagctccaatcag
accaccaacgaagacattaaaggctcgtggtcgaccaaacgggcgaaggacaactacaac
ccctacagctacgggaacatcctgaccaactgctgtgctgccctttgtggtcctcttcca
cccagtcttattgacagaagaggcttgatccagtcagacacaccccagcctgtgtcacac
tccaacgggagcagcatgtacaactccacccagcttcacactcacatgtgtgaccaagag
cactgcattcagagcaccaaattcgttttgcaggctgccgctacccccctgctccacagc
gaccctgtcatgatgggcggagagggacccactctccctgggaagagttccctggggggc
ccctgtgcctcactggcccccagccagccttccctgccctcctccatgccaggcctgggc
tgtgcaggggacatgctgaccctgagggacccagacacccactgccaccaccatcacttt
gtcagccctgaggagacgccctcgcccggccccatgcctctgactctgccctgccccgcc
cacatgacccacgggggacacatgaacccggcccaactctacgaccctgccagccaggac
tctctgcacgaggactctgtcaggggcctggtcaaactcagctctgtctga

DBGET integrated database retrieval system