KEGG   Salvelinus alpinus (Arctic char): 111956491Help
Entry
111956491         CDS       T05762                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: rho-associated protein kinase 1-like
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04270  Vascular smooth muscle contraction
salp04350  TGF-beta signaling pathway
salp04510  Focal adhesion
salp04530  Tight junction
salp04810  Regulation of actin cytoskeleton
salp05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:salp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    111956491
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111956491
   04530 Tight junction
    111956491
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111956491
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    111956491
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111956491
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:salp01001]
    111956491
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:salp03036]
    111956491
Enzymes [BR:salp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111956491
Protein kinases [BR:salp01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   111956491
Chromosome and associated proteins [BR:salp03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    111956491
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Rho_Binding PH HR1 Cortex-I_coil C1_1 Pkinase_C Filament
Motif
Other DBs
NCBI-GeneID: 111956491
NCBI-ProteinID: XP_023832711
AA seq 1392 aa AA seqDB search
MSAGESLEARFEKIDAMLKDPKSEINTDCLLDGLDALVYDLDFPALRKNKSIDNFLNRYK
DTISKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKATMKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSALVVQLFYAFQDDRYLYMVMEYMPGGDRVNLMSNYDVPEKWARFYTX
EVVLALDGIHAMGFIHSVFLCPFRDVKPDNMLLDKAGHLKLADFGTCMKMNKDGMVRCDT
AVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNH
KNALTFPEDSDISKDAKNLICAFLTDREVRLGRNGVDEIKRHPFFKNDQWTWENIRETAA
PVVPELSSDIDTSNFDEIEEDRGDEETFPIPKAFVGNQLPFVGFTYYSSHQFSRSTSTKS
VDKRSSSTKEDKSHLENLQKRIYQLEEHLHSEMQLKDEMEQKCRTTNTKLDKIMKELDEE
ANVRKGVEASMSLLEKDKMMIQHRATEYQRKVDQEAEKRRNMENEVSTLKEQLEVMRKIS
QNSQASNDKILQLQKQLEEANDLLRVESDTAARLRKSHTEMAKSMSQLEGLTSELQEKSR
SADGGRAQLEKELLQLQSTLDSERRSYSKGSEEIHELQARMTGLQQDNKNLKLSLSKVET
ERKQAQERSNNLEKDKNNLEIDLNYKLKTLQQRLDQEHTEHRVTRAQLTDKYESIEEAKS
AAMHAVQHKVSEESGARMRAESRVVEVEKQCSMLEFDLKQSVQKMEQLMKQKERLEDEVQ
GLRIHLEQESSKRLLAQNELKSRSQEADRLKGSEKQLKQEINTALESKRSLEFQLAQLTK
QYRGNEGQMRELQDQLEAEQYFSTLYKTQVKELKEDIEERNRQVQEVHKKVHELHSERDS
LSAQLDLTVTKAESEQLARALQEEQYFELSQENKKAMARHKQEGSERDSTIARLEESNKT
LTKDVENLSKEKAELDHKLRTQEEEYDSQKEEITNTIKANYEKVLSTERTLKTQAVNKLA
EIMNRKDMKLDTKKKGSTTDLRKKEKENRKLQVDLNQEKEKFNHMAIKYQKELSEMQAQL
SEECTYRNELQMQLDSKESDIEQLREKLNDLQLRMDNSSVISLQTDETDSNIAESRLEGW
LSIPNKPNIKRYGWKKQYVVVSSKKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDV
YRAETEEIPRIFQILYANEGECRKEADMETVSQGDKTNCLPHKGHEFIPTLYHFPSNCEA
CSKPLWNVFKPPHALECRRCHVKCHRDHLDKKEDVIAPCKVNYDVTSARDMLLLALTQDE
QKKWIGHLGKKIPKTPPSSFLRASPRTLSTRSGTNQSFRKNPKSITGKPRSQSHSATTAS
SLQATDTTSSTC
NT seq 4179 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctggagaaagtttggaggctcgttttgagaaaatcgatgccatgttgaaggac
ccgaagtcggaaattaacacggattgccttttggatggcttggacgcgttggtgtacgac
cttgactttccagccctgagaaaaaacaaaagcatcgacaacttcttgaatagatataag
gacacaatcagtaagatccgggacctgcggatgaaagcagaggactatgaggtggtcaag
gttatcgggagaggggcgtttggagaagtgcagttggtaagacacaaagccacgatgaag
gtgtatgccatgaagctgcttagcaagtttgagatgataaagaggtcagactctgctttc
ttctgggaggagagggacatcatggcctttgccaacagcgccctggtggtgcagctgttt
tatgcgttccaggacgaccgttacctctacatggtgatggagtacatgcccggcggagac
cgtgtcaacttgatgagcaactatgacgtccctgagaagtgggcccgcttttacaccnnc
gaggtggtgctggctctggacgggatccacgccatgggattcatacacagtgtcttttta
tgtcctttccgggacgtgaagcctgataacatgttgctagataaagcgggccacttgaag
ttggcagactttgggacctgtatgaaaatgaacaaggatggtatggtccgatgcgacaca
gcagtgggaacgccagactacatttcgccagaggtactaaaatcccagggaggagatgga
tattacggccgggagtgtgactggtggtccgtgggagtcttcctatatgagatgcttgtc
ggtgacacaccgttctacgctgactcgttggtggggacgtacagtaagatcatgaaccac
aagaacgcactaaccttccctgaagacagcgacatctccaaggacgccaagaacctcatc
tgtgccttcctgactgacagggaggtgcgactgggccgtaacggggtggatgagatcaag
aggcatcctttcttcaagaacgaccagtggacatgggagaacatccgagagacggcggcc
ccggtagtgcctgagctgagcagtgacatcgacaccagtaactttgacgaaattgaggag
gaccggggagacgaggagaccttccccataccgaaggcctttgtgggcaaccagctgccc
tttgtggggttcacctactatagcagtcaccagttctcccggagcaccagcaccaagagt
gttgacaaacgcagcagctccaccaaggaggacaagagccatctggagaacctgcagaag
aggatctaccagctggaggagcacctacacagtgagatgcagctaaaggatgagatggag
caaaagtgcaggacgacaaacacaaaactcgacaagatcatgaaagagcttgacgaggaa
gccaacgtgaggaagggtgtggaggccagtatgtccctcctggagaaagacaagatgatg
atccagcaccgagccacagagtaccaaagaaaggttgaccaggaggccgagaagagacgc
aacatggagaacgaggtgtccactctgaaagagcagcttgaggtcatgaggaaaatcagc
caaaactctcaggcctcaaatgacaagatcctacaactgcagaagcagctggaggaggcc
aatgacctgctgagggtggagtcagacacagcggcgcggctgaggaagagccacacggag
atggccaagtccatgagccagctggaggggctgaccagcgagctgcaggagaagagtcgc
tcggcagacggggggagggcccagctggagaaagagctgctgcagctgcagagcaccctg
gactctgagaggaggagctacagtaagggatcagaggagatccatgagctacaagcgcga
atgacgggtcttcaacaggacaataagaacttgaagctcagcctgtctaaagtggagacg
gaacgcaagcaggcccaggagaggagcaacaacctggagaaggataagaacaacctggag
atcgacctgaactacaagttaaagacactgcagcagcgtctggaccaggagcacacagaa
cacagggtgacgcgggcccagctcacggacaaatacgagtccattgaggaggccaagtca
gccgccatgcatgcggtgcagcacaaggtgtctgaggagagcggggcgcggatgcgagcg
gagagcagggtggtggaggtagagaagcagtgctccatgctggagtttgacctcaagcag
tcggtgcagaagatggagcagctgatgaagcagaaggagaggcttgaggacgaggtgcag
ggtctgcggatccatctggagcaggagtccagtaagaggctgctagcccagaacgagctc
aagagccgctcccaggaggcggaccggctgaagggctcggagaagcagctgaagcaggag
atcaacacggcactagagagcaagcgctctctcgagttccagctagcacagctcaccaag
caatacaggggcaacgagggacagatgagggaacttcaggaccagcttgaggccgaacag
tatttctcaacgctttataaaactcaggtgaaggaactgaaagaggatattgaggagagg
aaccggcaggtccaggaagttcataagaaggtgcatgagctgcacagcgaaagggactcc
ctgtcagcccagctggatctgacagtgaccaaggcggagtcagagcagctggccagggcg
ctccaggaggagcagtactttgagctgagccaggagaacaaaaaggccatggccagacac
aagcaggagggttccgagagggattcaaccatcgcacggcttgaggaatccaacaaaacc
ctgaccaaagacgtggagaacctcagcaaggagaaggccgagctggaccacaagcttcgc
actcaggaggaagagtatgactcccagaaagaggagattacaaacacaatcaaggccaac
tatgagaaggttctcagcacagagcgcacgctcaagactcaggcggtgaacaaactggca
gagatcatgaacaggaaggacatgaagcttgacaccaagaagaaggggagcacgaccgac
ctgaggaagaaggagaaggagaaccgcaagctgcaggtggatctcaaccaggagaaggaa
aagttcaaccacatggccatcaagtaccagaaggagctcagcgagatgcaggcgcaactg
tcggaggagtgcacgtaccgcaacgagctgcagatgcagctggacagcaaggagagtgac
attgagcagctcagggagaagctcaacgacctgcagctgcgcatggacaactccagcgtc
atcagcctgcagacggatgaaacagacagcaacatcgctgaatccagactggaaggttgg
ctgtccattcctaataaacctaatatcaaacgatatggctggaagaagcagtatgtggtg
gtgagcagcaagaagattctgttctacaacgatgaacaggacaaagaacagtccaacccc
tccatggtactagatatcgacaaactgttccacgtgcgtccagttacccagggtgatgtg
taccgagcagagacggaggagatcccaaggatattccagatcctgtatgccaacgagggg
gagtgcaggaaggaggcggacatggagactgtctcgcaaggggacaagaccaactgtctg
ccccacaaaggtcatgagttcatccccacgctctaccacttcccttccaactgcgaagcc
tgctccaagcccttgtggaacgtcttcaagcctccacacgccttggagtgccgccgctgc
cacgtcaagtgccacagggaccacctcgacaagaaggaggacgtcatcgccccctgcaaa
gtgaactacgatgtgacctctgcccgggacatgctcctgctggccttgacccaagacgag
cagaagaaatggattggccacctgggcaagaagatccccaaaacaccgccctcctccttc
ctgagggcgtcgccccgcaccctgtccacccgctccggaaccaaccagtcctttcgcaag
aaccccaaaagcataacgggcaagccaaggtcgcagtctcattctgctaccacagcctcc
agcctccaagcaacagacacaacatccagcacttgttga

DBGET integrated database retrieval system