KEGG   Salvelinus alpinus (Arctic char): 111956628Help
Entry
111956628         CDS       T05762                                 

Definition
(RefSeq) complement factor B isoform X1
  KO
K01335  complement factor B [EC:3.4.21.47]
Organism
salp  Salvelinus alpinus (Arctic char)
Brite
KEGG Orthology (KO) [BR:salp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:salp01002]
    111956628
Enzymes [BR:salp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.47  alternative-complement-pathway C3/C5 convertase
     111956628
Peptidases and inhibitors [BR:salp01002]
 Serine peptidases
  Family S1: chymotrypsin family
   111956628
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin VWA Sushi DUF1986 Trypsin_2
Motif
Other DBs
NCBI-GeneID: 111956628
NCBI-ProteinID: XP_023832905
AA seq 754 aa AA seqDB search
MRPEILTLIYSLILCLVCTVVLSGVSVCSTDGMSIRGGEYSLSNGSNVGSELLYHCPDGY
YPYPKRMHRCLGHNRWSPSPSRRGSECRVMTCPYPSELRNGEVSPGLLRYVVGDQTTYEC
HDGYVFAGSASRVCQSNGKWSGDTPICDHGSGHCRDPGVPPGAKRNGNMLDIGDRVTYEC
SLGLMLLGSKERICLEGGDWSGTEPVCYSKNYYDTPEEVSKYFSTSLENRLAISGLDDNT
DGQQVQRSIQMRQGGKLHIYIALDNSGSISRDNFTVAKNCVTALINQISFFEVIPRYGIL
SFASEVNEIVDIFSPSSHSDMVLQNLSNVTYGKLNGTGSNLSKVFKKILEKMAVFKERNE
LEDTQQAIIMFTDGKTNMGGSAEPTVIRIRNLMEEIHGKDWQKYLDIYVFGVGAEMNEEE
INKLVSKKSSEKHFYKLRDDTKLTSLFKMIIDESNSVNLCGLSWDRDGDDSTTSKRQEYP
WVVTISVLVGNEHSSCMGALVTPRFVLTAAHCFREKQIDMIKVKVSDQEDMTLEQKPIIH
PEYDVFKKKDKGVSEFYDYDVALLKLNSDVKRSKYIRPICIPCTESSIRASGLHTSTTCK
AQEEFLLNQNSVPARFMSEWKGQMYEKDVQIKLKEKRESCIKDAEEAEGIKNYKEAVTKN
FLCTGGTDDKVEDIACKGDSGGALYLKNLKRRIQVGVISWGVKDLCMGNNIPKPLSTATT
RDYHINLFRMQKFLKEHLGEKKNETNYEPLKFVD
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atgagacctgaaatattgactttgatatactccttaattctctgccttgtctgcactgta
gtcttgtctggagtttctgtctgcagtactgatggcatgtccattcgaggaggggagtac
agtctctcaaatggatcaaatgtgggcagtgagctgttgtaccactgtcctgatggttat
tacccttaccccaaacgtatgcacagatgtctgggccataatcgctggtccccaagcccc
agtcgacgaggcagtgagtgcagggtcatgacatgcccttatcccagtgagctgagaaat
ggtgaggtgtctcctggtctattgcggtatgttgttggggaccagaccacttatgaatgc
catgacggttacgttttcgccggctccgcctccagagtctgccagagtaatgggaagtgg
agtggtgacacgcctatctgtgatcatggctctggacattgccgtgaccctggcgttccc
ccgggggccaagcgcaatggaaatatgcttgatataggtgaccgggtgacctatgaatgt
tctttaggactgatgctgctgggatcgaaggagcggatatgcctggagggtggagactgg
tcaggaactgagcctgtctgttacagtaaaaactactatgacaccccagaggaggtgtcc
aagtacttctctacatccctcgagaatcgtctggccatatctggcctggatgacaatact
gatgggcagcaagtacaaaggtccatccagatgaggcagggaggcaagctccacatctac
attgctctggataattcagggagcataagcagagataattttactgtggccaaaaactgc
gttacagcactcatcaaccagatatctttttttgaagtcatcccaaggtacggaattctg
agctttgcttctgaggtcaatgagattgttgatatcttctctccttcctcacactcagac
atggttttacagaacttaagtaatgtcacctatggtaaattaaatggtactggaagtaac
ctctcaaaggtgtttaaaaaaatccttgaaaagatggctgtctttaaggaacgaaatgag
cttgaagacacacagcaggccattattatgtttacagatggcaagactaacatgggggga
agtgcagagcccactgttatcaggattaggaacctgatggaagaaatacatggcaaagac
tggcagaaatatctggatatttatgttttcggtgtgggggcagaaatgaacgaggaggaa
atcaacaagttggtgtcgaagaagagttcagaaaagcatttctacaaactaagggatgac
accaaactgacatccttgttcaagatgattatagatgagagtaacagtgtaaacctgtgt
ggtctatcctgggaccgcgatggtgatgattccactacatccaaacggcaagaataccct
tgggtagtcacaatctctgtcttggtcggaaatgagcatagctcttgcatgggtgccctt
gttacacctagatttgtccttacagctgctcactgtttcagggagaagcagatagatatg
attaaagtgaaggtctctgaccaggaagatatgacgttggagcagaaacctataattcat
ccagaatatgatgtctttaagaagaaggataagggggtttcagagttttatgactacgat
gtggcactcttgaagttgaatagtgatgtcaaaaggtctaaatatatcaggcccatctgt
attccttgtactgaatcctccatccgtgcgtcaggtctccatacatcaacaacctgtaag
gcgcaagaggaattcctattgaatcagaattctgtacctgccagattcatgtctgagtgg
aagggtcagatgtacgagaaggatgttcaaatcaaattgaaagaaaagagggagagctgt
attaaggatgcagaggaagctgagggcattaaaaactacaaggaggctgtgactaagaac
ttcctgtgtacaggagggacagatgacaaagttgaggacattgcctgcaaaggtgactct
ggtggcgccctgtatctgaaaaatctaaaacgtcggattcaggtgggtgtgatcagctgg
ggggttaaggacctgtgtatgggtaataatatcccaaagcctctttcaactgcaactact
agagattaccacattaacctattccgaatgcagaagttcctcaaggagcacctgggagaa
aaaaaaaatgaaactaattatgagcctttaaaatttgttgactga

DBGET integrated database retrieval system