KEGG   Salvelinus alpinus (Arctic char): 111957005
Entry
111957005         CDS       T05762                                 

Definition
(RefSeq) uncharacterized protein LOC111957005
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
salp  Salvelinus alpinus (Arctic char)
Brite
KEGG Orthology (KO) [BR:salp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:salp03000]
    111957005
Transcription factors [BR:salp03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    111957005
SSDB
Motif
Pfam: PAS HLH PAS_3
Other DBs
NCBI-GeneID: 111957005
NCBI-ProteinID: XP_023833482
AA seq 662 aa
MIPPGDCLYAGRKRRKPIQKQKQTAASQKTNPSKRHRDRLNAELDRLASLLPFTPDIISK
LDKLSVLRLSVSYLRVKSFFQAIQEKPCRKHIMESPVNHQDTRKESLSMGTPGTSSSVVE
SDLLLESLTGFALVVSTDGLIFYTSTSIVDYLGFHQTDVMHQNVLDYIHVEERQEFRRQL
HWAMNPGTQGASLDQHSATGTGDDFVMSSLFNAQEPDGVPLERTSFLTRCFISRVRCLLD
STSGFLSMQFQGSLKFLQGQKKKTDSGAQLPPQLALFCVAVPLMMPSITELKMKSMTIRN
KKKGPVNPTPDKHSDKRHRSTRGSCDSSDLLLLNCSSSSTRDPCHYTPWTPLSKDCIRYR
NNGYYTQEEPINFCLSSMGGGPKAQSVNHPWDIRIGSTIRKGPSSSYIPWRQGKYNNLGK
SGAYRMSPGYHAKRQVASQNKLYGGLHSPEVESFCEDGMKADNNYMGGHLDCYNGMVLPE
XAIKTEQDSDSENGCNIYSMPHSGAWVGNEKRYSMGYSEEPQVKSEADYYDQYTTCQRNK
SNMSPMLNGYHKYLYPVGSRAQKDHRIPHSDPLCSSHGANCMDSNVYGNGTVEHKGYMQQ
DNKLNYEFRNHLVHSIKREPMDSPPWSGNGHDISQIPMQRNMIHNCALNDIVHKPNPYIY
MQ
NT seq 1989 nt   +upstreamnt  +downstreamnt
atgattccacctggggactgcttatatgctgggaggaagagaaggaagcccatccaaaaa
caaaaacagacagcggccagccagaagaccaacccgtcgaagaggcaccgtgaccgtctg
aatgcagagctggaccggctggccagtctcctacccttcaccccagacatcatctccaaa
ctggacaagctctcagtgctgcgtctcagcgtcagctacctccgggtcaaaagcttcttt
caagccatccaggagaagccttgcagaaagcacatcatggagtcgcctgtgaaccaccag
gataccaggaaagagagcctgtccatggggaccccggggaccagcagcagcgtggtggag
agtgacctcttactggagtccctgactgggtttgccttggtggtgagcacagacgggttg
atcttctacacctccacctccattgttgactacttgggctttcatcagacggatgtgatg
caccagaatgttcttgattatatccatgtggaggagcggcaggagttcagaagacaactc
cactgggccatgaaccctgggacccagggggcctccctggaccagcactcagccacagga
actggtgatgactttgtgatgagcagtctctttaacgcccaggagcctgacggtgttcct
ctagagcgcacctccttcctcactcgctgtttcatttcccgtgtccgttgcttgctggat
agcacctcaggcttcctgagcatgcagttccagggcagcctgaagttcctgcagggccag
aagaagaagacagactccggggcgcagctacccccccagctggccctgttctgtgtggcc
gtgcccctcatgatgccctccatcacagagctgaagatgaagagcatgacgatcaggaac
aagaaaaagggccccgtcaaccccacaccagataagcacagtgacaagaggcatcgctcc
accagaggttcatgtgacagcagtgacttactgcttctgaattgttccagcagctctacc
agagacccctgccactacaccccatggacacccctctccaaagactgcatcaggtatagg
aacaatggttactacacccaggaggagcccatcaacttctgcctgtcttccatgggtggt
gggcccaaagctcagagcgtgaatcatccatgggacatccgcatcgggtccaccataaga
aagggccccagcagtagctacataccatggagacaaggcaagtacaacaacctggggaag
tctggagcttacaggatgtctccaggatatcacgctaaaagacaggttgcctctcagaac
aaactgtacggaggcctccacagcccagaggtggagagcttctgtgaggacggcatgaag
gcagacaacaactacatgggcggccatcttgactgttacaatggcatggtgttgcctgag
mcagccataaagacagagcaggactctgactctgagaacggttgcaacatctacagcatg
ccccacagcggagcctgggtggggaacgagaagcgctacagcatgggctactcagaagaa
ccacaggtgaagtcagaggccgactactacgaccaatacaccacctgccaaaggaacaag
tccaacatgagcccaatgctcaacggataccacaaatacttatacccagtggggagcagg
gctcagaaggatcataggatacctcactcagaccctctttgtagcagtcatggagcaaac
tgtatggacagcaatgtatatgggaatggtactgtggagcataaagggtacatgcagcaa
gacaacaaactgaactacgagttcaggaatcatctggtccactctataaagagggaaccc
atggactcacctccttggtctggcaatggacatgacattagccaaatacccatgcagaga
aatatgattcacaattgtgcattgaatgatattgtacacaaaccaaacccatatatctac
atgcaatga

DBGET integrated database retrieval system