KEGG   Salvelinus alpinus (Arctic char): 111957513
Entry
111957513         CDS       T05762                                 

Gene name
adamts13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
salp  Salvelinus alpinus (Arctic char)
Brite
KEGG Orthology (KO) [BR:salp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:salp01002]
    111957513 (adamts13)
Enzymes [BR:salp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     111957513 (adamts13)
Peptidases and inhibitors [BR:salp01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   111957513 (adamts13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin Reprolysin_3 Reprolysin_4 Reprolysin_5 TSP1_CCN TSP1_spondin Reprolysin_2 Peptidase_M10
Other DBs
NCBI-GeneID: 111957513
NCBI-ProteinID: XP_023834125
AA seq 1549 aa
MAALALLCLLSVLPGSTAILMRSPLEELFLHSLDQKDMVFYFGTDSATSVPEFQLIWTDC
ASTELHTGPWRCSFETEGKRFVLGLGERKQSFSCQSTLETARNTTLNIIRKSHAMCCQQA
KVLHPPSTKGFLTICARKMQGLVVAGKEKERLYIQPVLQKHIHLTEARNCSSPRIPHLVF
HQPFTARGPPRHSHMKRLRRQRSAIMPEVTHLELLVVVAPDVQLVHRQDTERYILTNLNI
ASELLRDMTLGANMRVHLVRMIILSEPEPEINISTNISSSLRSVCEWARRVIPSNDTDPL
HADLVLYITRFDLELPNGNKQVRGVAQLGGACSSQWSCVITEDTGFDLGITIAHEIGHSF
GINHDGIGNTCSSSGFMMASDGGYNSVDLTWSQCSRQQLYTFFSEGKADCVKDLPVLVGS
LQDWKPGLYYGVDDQCRIAFGSTARACSFTNPDLPVCRVLSCHIKPDDNSSCKRLLVPLL
DGTECAPNQWCLKGRCVSPDQLSSSSSVVVHGSWSSWSQFSPCSRICGGGVTSRTRQCNN
PRPAFGGNDCKGRDTEAELCHQQQCERTQLAFMAEQCAQTDLQPLYLSPNTASLYTWIPA
VGFVTGDEQCRYMCQCKGENFIVSRGSQFVDGTRCEPDSPAPLGATTACLGGMCQLFGCD
GVLKSGKVEDVCGVCGGDGSSCSLTSQSYSGGQAREYVTFLTLPVNATQVHIVNRAPVFT
HLAVLIGNQYVVSGSGGIALNITHPSPLEDGRLVYRLYLTPDLLPLMEELLLHGTVTEET
HIQVYRKYGKEYGEQTSPNITYHFYTPISNNAFIKEIPRGKWTVVTTSCSVTCGSGIQKS
MYVCMDEDTKEHLEEVYCDSAPLLLLQQTTCHLPACPPSWEMGEFGPCSALCGGGEKVRP
VRCVQRQGADVLQVAVSECPQHSATQSVDTCNFQPCPARWNASEAGECSAVCGPGAAKRV
VTCVRSEGGHDVEVDHSLCSGLFKPPVLVSCVIDVCPIGWESKGQDQPILNKSPGLRYRS
RYLTVYVWSPMIGQCSKTCGNGTLQVWFSCLDHQTRLAVPEVYCDASSKPEPHTESCNPS
PCPPMWRYKQGVCSVSCGGGVAHRVLYCSQETEGDEEVVVNNTECSNMTKPIAVVTCNSN
SCPARWRVLRTGACSMSCDLGLARRHVSCVEYIHGEDSEVSEERCHAAVKPATTVPCLXQ
VCTFRWDVKDWNQCSVPCGYGIQSRAVSCMGPTKPEPLSPLLCMHMPKPITIRGCQMDDC
RVLEXTSPLTHTHTTNAPSLETRDQLPSPQGMEVTPMDEELSPTLSLTQTPPTATELITP
AMPTVTPKTSLCGQLLLGESGTVDLRHETGRCILSIGRPLDEVIHMKVESSSLSCKKREY
VAFYDRLVLVRKCDQLEDTELTSRTNVLLVRQHLLSPGNGVLLTYSSQKNNKKSHHQDCD
VQLFAPSGVIENPTMTSALGSHTCRVLINAPPSVKIRIRALSMGPVVNSTAAQSTFIMIR
DVDVLKTNVFKGQQLFDWRSAGNMAEIEFHGEYLQSNGSFRAEYSFVEP
NT seq 4650 nt   +upstreamnt  +downstreamnt
atggcagccttggcgctgctttgtctgctgtcagtgctgccaggctccacagcaatacta
atgagatctccattggaggagctatttctgcactccctggatcaaaaggacatggtgttt
tattttggtaccgactctgctacctcagtgccggagtttcagctcatctggacagactgt
gcctctacggagctccacactggcccctggcgatgctccttcgagaccgaagggaagcgc
tttgtgctggggctcggggagaggaagcagtccttctcctgtcagtccacattagagaca
gctcggaacaccactctcaacatcataaggaaaagtcatgccatgtgttgtcagcaggcc
aaagttctacatcctccttcaactaaaggatttctcaccatctgtgccaggaaaatgcaa
ggcctggttgttgcaggtaaagagaaggagagactatacattcagccagtgcttcaaaaa
cacattcatctgactgaagccagaaactgttccagtccaagaatacctcatctggtgttc
caccagccatttactgccagaggcccccccagacactctcacatgaagaggctgcgtcgc
caaaggtcagccataatgcctgaggtgacccacctggagctgctagtggtggtggcgcct
gacgtgcagctggtccacaggcaggacacagagagatacatacttaccaacctcaacatt
gcctcagagctgctgagggacatgacactgggagccaacatgagagtgcatctggtccgt
atgatcatcctctcagaaccagagccagagattaacatctccaccaacatctcctcgtct
ctgaggagtgtgtgtgagtgggccagaagggtcatcccctctaatgacacggaccccctg
catgctgaccttgtgttatacatcacaagatttgatctggagctgcccaatgggaacaag
caggtgaggggcgtggcccagctaggcggggcatgttctagccaatggagttgtgtaatc
acagaggacacaggctttgatctgggcatcaccatcgctcatgagataggccacagcttt
ggtataaaccatgatgggattggtaacacatgcagcagcagtggctttatgatggcctct
gatggaggctacaacagtgtggatctcacctggtcccagtgcagcagacagcagctgtac
acattcttcagtgaaggcaaggctgactgtgtgaaagacttgcctgttctggttggctct
ctgcaagactggaagccaggcctttactatggcgtggacgaccagtgccggatagcgttt
ggtagcaccgccagggcctgctccttcaccaaccctgacctgcctgtgtgccgtgttctc
tcctgccacatcaaacctgatgacaacagctcatgtaaacgtctgctggtgcctctgttg
gatgggacagagtgtgcacccaaccagtggtgcctgaagggccgctgtgtgtccccagac
cagctcagctcctcttcctctgtggtggtgcacgggtcctggtccagctggtcccagttc
tccccatgctcgcggatatgtggcgggggagtcacttcccggaccaggcaatgcaacaac
ccacgacctgcatttggtgggaatgattgcaarggcagggatacagaggcggaactttgt
caccagcagcagtgtgaaaggacccagctggccttcatggcagagcagtgcgcccagaca
gatctacagcccctgtacctgtcccccaacacggcctccctctacacctggatccccgct
gtaggctttgtcacaggggatgaacagtgcaggtacatgtgccagtgtaagggagagaac
ttcattgtgagccgtgggtctcagtttgtggatgggactcgttgtgaaccagacagtcca
gctccccttggtgccacgacagcttgtctaggagggatgtgccagctgtttggctgtgat
ggagtgttgaagtctgggaaggtggaggatgtgtgtggggtatgtggaggggatggctcc
tcttgcagtctcacctctcagtcttacagtggtggtcaggccagagagtacgtcacattc
ctgaccctgccagtaaacgccactcaggttcacattgtcaacagggcacctgtcttcact
cacctggcggtgttgattgggaatcagtatgttgtgtctgggagtggcggcattgcgtta
aacatcactcacccctctcctctggaggacggtcgtctggtttatcgtctgtacctgacc
cctgacctcctgcctctcatggaggagctgctgctacatggaactgttacagaggagaca
cacatacaggtctatcggaaatatggaaaagaatatggagaacaaaccagtccaaacatc
acctaccacttttatactcccattagtaataatgcttttataaaagagatacccaggggc
aagtggactgttgttacaacatcctgctctgtcacttgtggctctggcatacagaaatct
atgtatgtctgtatggatgaagacaccaaggagcatctggaggaggtctactgtgattca
gctccccttctcctgcttcagcagacaacctgtcacctcccagcctgtccccccagctgg
gagatgggagagtttgggccctgcagtgccttgtgtggtggtggagagaaagtgcgccct
gtgagatgtgttcaaaggcaaggagcagatgtcctacaggtggccgtttctgaatgtcca
caacactcagccacacaatcagtggatacatgcaactttcaaccctgccctgcaaggtgg
aatgcgtcagaagccggggagtgttcagcggtgtgtgggcccggagcggccaaacgcgtt
gtgacatgtgtgcggtccgaaggtggtcatgatgttgaggtggaccatagcttgtgttca
gggctcttcaaaccacctgtcttagtgtcttgtgtgatcgatgtctgccctattggctgg
gagtctaagggacaggatcaacctatacttaacaaatcccctggtttaaggtaccgctcc
aggtacctaacagtgtatgtttggagccctatgataggccaatgctcaaagacctgcgga
aatggtaccctgcaggtgtggttttcatgtctggaccaccagaccaggctagcggtgcct
gaggtctactgtgatgcctccagcaaaccagagcctcacacagagtcctgcaacccttcc
ccttgccctcccatgtggcgctacaagcagggagtgtgcagtgtgtcgtgtggaggaggc
gtggcccatagggtgctatactgctcccaggagaccgagggagatgaggaggtggttgtg
aacaatacagagtgcagtaacatgaccaaacccatagcagtggtcacatgcaactccaac
agctgtccagccaggtggagagtgctgaggacgggggcctgttctatgtcttgtgatctg
gggttagccaggaggcatgtctcatgtgttgagtatatccatggggaggacagtgaggtg
tctgaggagagatgccatgcagccgttaaacctgctaccacggtaccctgtctgrtgcag
gtgtgcaccttcagatgggacgtgaaagactggaatcagtgttcagtgccgtgtgggtat
gggatccagtcgagagcagtgtcctgcatgggacccactaagcctgagcccctcagccca
ctgctctgcatgcacatgcccaagcccatcaccatccggggctgccagatggacgactgc
agggtcttagagawgactagtcccctcacccacacacacaccaccaacgccccctcacta
gagaccagggaccagttacccagtccccagggcatggaagtcactcccatggatgaggag
ctgtctcctactctcagcctgacccagacacccccgactgcaacagaactgatcacccca
gccatgcccactgtgacacctaaaaccagtctgtgtgggcagcttctgctgggggagtca
ggcacagtggacttgagacatgagacaggtcgctgcatcctgtcaataggccggcccctg
gatgaggtcatccacatgaaagtagagtccagctccctaagctgcaagaaaagggagtat
gtggcgttctatgacaggctggtactggtcaggaagtgtgaccagcttgaggacactgaa
ctgacctccaggaccaacgtcctgctggtgcgccagcatctcttgtcccctggaaacgga
gtgctgctcacttacagcagtcagaagaacaacaagaagagtcaccaccaggactgtgat
gtccagctgtttgctcccagcggggtcattgagaatccaacgatgacctcagcgttgggc
agtcacacctgtcgagtcctcatcaacgcccctccctcagtgaagattaggatccgggct
ctgagcatgggccctgtggtcaacagcacagcagcccagtccaccttcattatgatacga
gatgtagacgtcttgaagaccaacgtgttcaagggccaacagctttttgactggcgatca
gctggaaacatggcagagatagaatttcatggcgagtacctgcaaagcaacgggagcttc
cgagctgaatactcattcgtggagccttga

DBGET integrated database retrieval system