KEGG   Salvelinus alpinus (Arctic char): 111957559Help
Entry
111957559         CDS       T05762                                 

Definition
(RefSeq) voltage-dependent calcium channel gamma-5 subunit
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04010  MAPK signaling pathway
salp04260  Cardiac muscle contraction
salp04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:salp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111957559
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    111957559
   04261 Adrenergic signaling in cardiomyocytes
    111957559
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:salp04040]
    111957559
Ion channels [BR:salp04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   111957559
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 DUF4064 COPI_assoc DUF716 Claudin_3 DUF4131 DUF4199 Tetraspanin YrhC
Motif
Other DBs
NCBI-GeneID: 111957559
NCBI-ProteinID: XP_023834214
AA seq 280 aa AA seqDB search
MTLCGRKVLTVLSSVFAVCALGLLGIAVSTDYWLYLEEGVILPLNQSTELRMSLHSGLWR
VCFTAGDEKGRCFTIEYVMPTNVQLTSESTVSVLKMIRSATPFPLVSLFFLFIGFVLSNI
GHIRPHRTILAFISGIFFILSGLSLVVGLVLYISSINDEMLNRTKTNEAYFSYQYGWSFA
FAAISFLLTETAGVMSVYLFMKRYTAEEMYRPHPGLYGPRHSNCSDYSGQFLHPDTWDQH
GRSPSSISSEASLQMNHSLHSNYPALLKCPEYDRMSSSPC
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgtgtggcaggaaggtgttgacggtgctaagcagcgtattcgctgtgtgcgca
ctgggcctgctgggcatcgctgtcagtactgactactggctctatctggaggagggtgtc
atcctgcccctcaaccagagcactgagttacgcatgtccctgcactcgggcctctggagg
gtctgcttcacagctggagatgagaagggccgttgtttcaccattgagtatgtgatgccc
accaacgtgcagctgacgtcggagtctacagttagtgtgctgaagatgatccgttcagcc
actcctttccctctggttagtctcttcttcttgttcattggttttgtcctgagcaacatc
ggtcatatccggccccaccgcaccatcctggccttcatctccggaatcttcttcatcctc
tcaggtctgtctctggtggtgggcctggtgttgtacatctccagtattaatgatgagatg
ttgaacaggaccaagaccaacgaggcctacttcagttaccagtacggctggtccttcgct
ttcgctgccatctccttcctgctaactgagacggccggcgtaatgtccgtctacctgttc
atgaagcgctacacggccgaggagatgtacagaccccacccgggcttatacgggccgcgc
cacagcaactgctccgactactctggtcagttcctgcacccggacacctgggaccagcac
ggccgcagcccctccagcatctccagcgaagcctcgctccagatgaaccactccctccac
tccaactacccagcgctcctcaagtgtcccgagtatgaccgcatgtcctcctccccatgc
tga

DBGET integrated database retrieval system