KEGG   Salvelinus alpinus (Arctic char): 111958719Help
Entry
111958719         CDS       T05762                                 

Definition
(RefSeq) B-cell antigen receptor complex-associated protein alpha chain-like isoform X1
  KO
K06506  CD79A antigen
Organism
salp  Salvelinus alpinus (Arctic char)
Brite
KEGG Orthology (KO) [BR:salp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:salp04090]
    111958719
CD molecules [BR:salp04090]
 Proteins
  111958719
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ig V-set Ig_3 Ig_6 Peptidase_A3 I-set ITAM Spo12
Motif
Other DBs
NCBI-GeneID: 111958719
NCBI-ProteinID: XP_023835730
AA seq 235 aa AA seqDB search
MVAVTFLFLCFWAAGVHGDLSRIQVTLEPDRPSLRVQLSHTAHLRCCYSATRGAVETTWY
ISIQTVNGTSALQGVDRRDNRVTVDEGNLTAAGVMCHTLILKEARLNDSGLYQCFLNHSA
LRHSVYTHGTFLQVYRPMVKILDIGESTKNSILTAEGMLLMVAVLLHGTMMLCKTKKLNQ
MKKKRVKKEEENIYEGLNLEECCSTYDQIQRSLVQGPYQDVGNMIMEEEIQLEKP
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggtggccgtgacattcttgttcctctgcttctgggctgcaggtgtccacggtgacctc
agccgtatccaggttactctggagccagacaggccctctctgagggtgcagctctctcac
accgcccacctgcgctgctgctactcagccacaaggggagccgtggaaaccacctggtac
atcagcatccagacggtcaacggcacgtccgccctgcagggagtggaccggagagacaac
cgtgtgacagtggatgaggggaacctgacggcggcaggggtcatgtgtcacacactcatc
ctgaaggaggcccgtctgaacgactcagggttgtaccagtgttttctcaaccatagcgcc
ctgcggcactctgtgtacacccacggcaccttcctgcaggtctacaggccgatggtgaag
attctggacatcggtgaaagcaccaagaacagcatcctgactgctgagggaatgttactg
atggtggcggtgcttctgcatggtaccatgatgctctgtaagacgaagaaactcaatcaa
atgaagaagaaaagggtcaaaaaggaagaggagaatatctatgagggtctaaatctggag
gaatgctgctccacatatgatcagatccagcgctctctggtgcagggcccctaccaagac
gtgggaaacatgattatggaggaggaaatccaactggagaagccttga

DBGET integrated database retrieval system