KEGG   Salvelinus alpinus (Arctic char): 111959241
Entry
111959241         CDS       T05762                                 

Gene name
aff3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
salp  Salvelinus alpinus (Arctic char)
Brite
KEGG Orthology (KO) [BR:salp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:salp03021]
    111959241 (aff3)
Transcription machinery [BR:salp03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     111959241 (aff3)
SSDB
Motif
Pfam: AF-4_C AF4_int
Other DBs
NCBI-GeneID: 111959241
NCBI-ProteinID: XP_023836490
AA seq 1103 aa
MKDIPAQALQAQTPTVNLEEESSSQRSLAQAQNTLRSWDTTDAQALGCTKEIYHPSTTQW
QLDKWLKKVPKKSSSCDQDPSNHDHAQRATEHRSLSPDPHRATSPSRPWGIREDYSPSQS
PVPSPRFNYSPRHSPRPSPGYSPCPSPCSSPCPSPTPRHSPIPSPVPSVCPSPFPSPRAT
CSLSSIPQHPPRSPSPSLTHSSPRRYPQVRSTHQESHRPPTWPSLTTSPSHRPKIRPWIA
PVPSTEPKSKPRHSPYPQPPPQHSSRPKSTQSQPVPTPKTTAKAAPALTTELSHRHKHRP
RPSPNSSPKLHSQPSLKHALTLAPKSQHLSNPRPSNGPSLTTRLSTRLSPTPRAKTLPTT
DPSRETSSRVSHCSKSSPKPHSLPNSKASSEPRAKSSPSPRPKVKSWAPAPHSKLPQRKP
QSREREQEVDNRRETHAPKRKVDRQTEGKGEHEVERQTEKQGERQGKKQKERKGERQGER
RLAEEQLLRRPWVQSSEEEEEEDVEERKRRREESEKEEKCKRRWEEQQQRGEWQAVQPKQ
RPHTNSERRHHPIDPQRHGTKKKRRRKSEEERQSQPDPSPPPSPSSPTPVVPPTDSSSSS
ESDSEPDLPPNVTKVPADSTSSQRPIPRRGYQGPGRPADSRSRVLYPRRTTASNPGQGHQ
IQGKQKLYTLVPFGRRELAAASHRGLRNLVVQIDLSLLNRVPDTTTGTPASHKHSSSSSA
SSKQKEAMRHLCIPETEKGDSKRKRKSENGVQHHRESKRSNSQTNGPFAHTESHRRLDPH
SDTRHNGFLEDYLDSTPLSDTADPTKPPIKTQNPEPKMEVECCVGVSGQPRPECEPWGPP
LQRAGGQRGTVTNHEPPHHAEYYMHEAKRMKHRADAMVDKLGKAVNYVDAALSFMECGKA
MEEGPLEAKSPYTMYAETVELIRYAMKLKNHSGPGARQEDQQLAVLCFRCLALLYWQMFR
LKKDHALKYSKALLDYFKSSPKVPTTPPIWSDSGKGTGGPPSSLSPSPSALTLGSHTGSS
PSSLISIPQRIHQMAANHLNITNSVLYSYEYWEVADSLARDNKEFFNYLNTLSGPLTLHS
SIAHAVQYTRQALQWIRISANVG
NT seq 3312 nt   +upstreamnt  +downstreamnt
atgaaagacattccagctcaggctcttcaggctcagactcctacagtgaatttggaggag
gagagcagtagccagcgctccttagcccaagcccagaacacactccgatcctgggacacc
accgacgctcaggcccttggctgcaccaaggagatatatcacccctccaccactcagtgg
cagctggataagtggctgaaaaaagtccccaaaaaatcctcttcctgcgaccaggatccc
agcaatcacgaccacgcccagagagctacagagcaccggtcgctctccccagacccccac
agagccacatctccatccagaccctgggggatcagagaggactacagccccagccagagc
cctgttcccagcccgcgcttcaactacagccccaggcatagccctcggcctagccctggc
tacagcccctgccccagcccctgttccagtccttgtcctagccccaccccaagacacagt
cccatccctagtccggtccccagtgtctgtccaagccccttcccaagccccagagccacc
tgcagccttagttccattccccagcacccccctaggagtcctagtcctagccttactcat
tctagcccccgccgctatcctcaggttcggagtactcatcaggaaagccacaggcctccc
acgtggcctagcctaacaaccagcccaagccatagacccaaaatcaggccctggattgcc
cctgtacccagcactgagcccaagagcaagccaagacacagtccatatcctcagcctcca
cctcagcacagctccaggcctaaatccacacagagccagcctgttcccactcccaagacc
acagccaaggcagcccctgctctgaccactgagctgagccacaggcacaaacacagaccc
aggcctagtcccaactcgagtcccaagcttcattcccagcctagcttgaaacacgcactc
actctagcccccaaaagccaacacctatccaaccccaggcccagtaatgggcctagtttg
acaaccagactcagtacccgtctcagtcccacacccagggccaagaccttacccaccaca
gaccctagcagagagaccagcagcagagttagtcactgttccaaatccagcccaaagcca
cattctctgcctaactccaaagctagttctgagcctcgcgctaaatccagccccagtcct
agacccaaagtcaagtcctgggcccctgctccccactcaaagcttccacagaggaagccc
caatctagggagagagaacaggaggtggacaaccggagagagacccatgcaccaaagagg
aaggtagacaggcagacagagggaaagggggaacatgaggtagagagacagacagaaaaa
caaggagagaggcaggggaagaaacagaaggaaagaaagggggagagacagggagagaga
agactggcggaggagcagttgcttagacgcccctgggtccagagctcagaggaagaggag
gaagaggacgtagaggagagaaagaggagaagggaggagagcgagaaggaggagaagtgc
aagaggaggtgggaggagcagcagcagagaggtgaatggcaagcggtccagcccaagcag
agacctcacaccaacagcgagcgccgccaccatcccatcgacccacaacgccacgggacc
aagaaaaagaggaggaggaagagtgaggaagagagacagtctcagccggacccttcccct
ccaccgtcaccctcctcccccactcctgtcgtcccacccacagactcctcctcctcttca
gagtccgactcggagcccgatctgcctcccaacgtcaccaaagtcccggccgactccaca
tcaagccagcgtcccatccccaggagagggtaccagggcccggggaggcccgcggatagc
aggtccagagtgctctaccccaggcgcaccaccgcatccaacccaggccaggggcaccaa
atccagggaaagcagaaactctacaccctggttccgtttggacgtcgtgagctggccgca
gcctcccatcgaggcctgagaaacttggtggttcagatagacctctccctgctcaacaga
gtgcctgatactacgacaggcaccccagcctctcacaaacactcttcctcctcctctgcc
tcttccaagcagaaagaagccatgagacacctgtgcatccccgagacagagaaaggagac
agcaagaggaaacgcaagtcagagaatggagtccagcaccacagagagagtaagaggagc
aactcccagaccaacggcccctttgcccacacagagtcgcacagacgtctagaccctcac
tcagacaccagacacaacgggttcttggaggactatctggacagtacccctctctctgac
accgccgaccccaccaagccccccatcaaaacacagaacccagagcctaagatggaggtt
gagtgttgtgttggggtgtcagggcagcctcggcccgagtgtgaaccatggggacctcct
ttacaacgggcagggggacagagaggaaccgtaaccaaccatgaacccccacatcatgct
gagtactacatgcatgaagccaagaggatgaagcaccgtgcagatgccatggtggataag
ctggggaaggcagtgaactatgtggatgctgctctctccttcatggagtgtggaaaagct
atggaggagggaccactggaggccaagtctccctataccatgtacgcagagacagtagag
ctcatcaggtacgccatgaagctgaagaaccactctggcccaggggctagacaggaagac
caacagttggccgtactgtgtttccggtgccttgctctcctatactggcagatgtttcgt
ctaaagaaggatcacgccctgaagtattccaaagctctattggactactttaagagttct
ccaaaagtgcctactactcccccaatctggagcgactcgggaaagggcacagggggacct
ccctcgtccctctcccccagcccctcagccctcaccctgggctctcacactggcagctcc
ccctcctccctcatcagcattccccaacgtatccaccagatggcagcaaaccacctcaac
atcaccaacagtgtcctctacagctatgagtactgggaggtagcagatagccttgccaga
gacaacaaggagttctttaactacttgaacaccctgtcggggccattgactctccacagt
agtattgctcatgcagtccagtacaccagacaggctctacagtggatacgcatcagtgcc
aatgtgggttag

DBGET integrated database retrieval system