KEGG   Salvelinus alpinus (Arctic char): 111959374Help
Entry
111959374         CDS       T05762                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: mitogen-activated protein kinase kinase kinase kinase 4-like
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
salp  Salvelinus alpinus (Arctic char)
Pathway
salp04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:salp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111959374
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:salp01001]
    111959374
Enzymes [BR:salp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111959374
Protein kinases [BR:salp01001]
 Serine/threonine kinases: STE group
  STE20 family
   111959374
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CNH Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 111959374
NCBI-ProteinID: XP_023990694
AA seq 1278 aa AA seqDB search
MANESPAKSLVDIDLASLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTE
DEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWVTGVEFCGAGSITDLLKN
TKGNTLKEDWIAYISREILRGLAHLHAHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLD
RTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSTGITAIEMAEGAPPLCDMHPM
RALFLIPRNPPPRLKSKKWSKKFCSFIEGSLVKNYTQRPPTDQLLKHPFIRDQPNERQVR
IQLKDHIDRTKKKRGEKDETEYEYSGSEEEEEEAQEQEGEPSSIVNQPGESTLRRDFIRL
QQENKERSEALRRQQLLQEQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRREREM
RRQQEREQRRREQDDKRRMEEVERRRKEEEERRRAEEEKRRADREQEYIRRQLEEEQRHL
EILQQQLLHEQAMLLVRPNCADERYRKNIQGSPQAAQVKVQPPVPPRAAETIANGNAPIA
VQPAMQRPMEPQVPVRTTSRSPVLSRRDSPLHGNLNATPNNPAGQRNACSAAAEPRLLWE
RVEKLVPRPTSGSGSTCSSSGSSNSSSQPSSHSGSGERFRARSSSKSEGSPLQHPEHTGK
KPEERKESVRTNRLADLTVLAKELRVVEDVQRPHKVTDYSSSSEESGTTDEDEDDEEVDQ
EGGEESTSGPEDSHAVSSRLSNGEMESVKTLIVHDEGESDSKITPCKDDTLIVRPSTGDN
KKRPAPSPGHGPVPGFNTSPGLIHPALQGLPGLQGHPGLQGHQEKNGFVGRIHLLPDLIQ
QSHHSPSSSASSSPSSSSMASPTMSMSPQSPLDKLSILLESHSVSNTMQKHKSSSSFTPF
IDPRLLQVSTSGAALNNLAFGNDARLAEALRADPSRKGSVVNVNPVNTRPQSDTPEIRKY
KKRFNSEILCAALWGVNLLVGTESGLMLLDRSGQGKVYPLISRRRFQQMDVLEGLNVLVT
ISGKKNKLRVYYLSWLRNKILHNDPEVEKKQGWVTVGDLEGAVHYKVVKYERIKFLVLAL
KNSVEVYAWAPKPYHKFMAFKSFGDLVHKPLLVDLTVEEGQRLKVIYGSSNGFHAVDVDS
GAVYDIYLPTHIQTSIQSHAIIILPNTDGIELLVCYEDEGVYVNTYGRITKDVVLQWGEM
PTSVAYIRSNQIMAXGGKAIEIRSVETGHXDGVFMHRRAQRLKFLCERNDKVFFASVRSG
GASQVYFMTLGRTSLLSW
NT seq 3837 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgagtctccagctaaaagtctagtggacatagaccttgcctctttgcgggac
ccagctggtattttcgaactggtggaagtggtcggcaatggtacctatggacaagtatac
aagggccgacatgtcaagacaggacaactggcggccatcaaggtcatggacgtcacagag
gatgaagaggaagagattaaactggagattaatatgctgaagaagtactcccaccacaga
aacatagccacctactacggagccttcatcaagaagagccccccaggacacgacgaccag
ctatgggtaactggtgtggagttctgtggtgcaggctccatcacagaccttctgaagaac
accaagggcaacacactgaaggaggactggatcgcctacatctctcgtgagatcctcagg
gggttggctcacctgcacgcccaccatgtgatccaccgtgacatcaagggccagaacgtg
ctgctaactgagaacgcagaggtcaaactagtggacttcggtgtgagcgcccagctggac
cggacagtgggtaggaggaacaccttcattggtacgccctattggatggcgcccgaggtc
atcgcctgcgacgagaacccagacgccacctatgactacagaagtgacttgtggtccact
ggaatcacagctatagagatggctgagggagctcctccgctgtgcgatatgcatccaatg
agagctctcttcctcatccccagaaaccctcctcctcgactcaagtcaaagaaatggtct
aagaagttttgcagcttcatcgagggctccctggtgaagaactacactcagcgccccccc
accgaccagctgctgaaacaccccttcatcagagaccagcccaatgaaaggcaggtccgc
atccagctcaaagaccacatcgaccgcaccaagaagaagaggggggagaaggatgagacc
gagtatgagtacagcgggagtgaggaagaggaggaggaagctcaggagcaggagggggag
cccagctccatagtgaaccaaccaggggagtcaaccctgcgtagggatttcatccgtctg
cagcaagagaacaaggagcgctcagaggccctgcgcagacagcagctcttgcaggagcag
cagctccgggagcaggaggagtacaagcgccaactactggcagagaggcagaaacgcatc
gagcagcagaaggagcagaggaggaggctggaggagcaacaacgtcgtgagcgggagatg
aggaggcagcaggagcgcgagcagcgtcgccgggagcaggatgacaagaggcgcatggaa
gaggttgaacgccggcgtaaagaggaggaggagcgcaggagggctgaggaggagaaaagg
agggctgaccgggagcaggagtacatccgtcgccagctggaggaggagcagaggcacctg
gagatcctgcagcagcagctgctccatgaacaggccatgctactggtgagaccgaactgt
gctgatgagaggtaccgtaagaacatccaaggttctcctcaggccgcccaggttaaggtt
cagccgccggttcctccccgcgccgccgagaccatcgccaatggaaacgcccccattgct
gtccagcctgccatgcaaaggcccatggaaccccaggttcctgtgaggacaacgtccagg
tctccagtactgtcacgcagggactctcctctccatggcaacctcaatgccacgcctaac
aacccggcgggccagaggaacgcctgcagtgctgcagcggagccgcgtctgctgtgggag
cgggtggagaaactggttcccaggccaacgagtggcagtggtagtacttgcagctcctcc
ggctccagtaactccagctcccagcccagctctcacagtggctcaggggagaggttcaga
gcccgctcctcatcaaagtctgagggttctcccctccagcatccagagcatactgggaaa
aaacctgaggagaggaaggagtcggtcagaactaaccgactggcggacctgaccgtgctg
gccaaagagctgcgtgtggtggaggacgtgcaacgcccccacaaggtgacggactactcc
tcatctagtgaggagtcggggaccacggatgaggatgaggatgatgaagaggtggaccag
gagggaggagaggagtctacctcaggaccagaggactctcacgctgtctcctccagacta
agcaacggagagatggaatcggtgaagaccttgatcgttcacgacgagggcgagagtgac
tctaaaatcacgccctgtaaagatgacactctgatcgtcagaccgagtacaggtgacaac
aaaaagcgacctgcccccagccctggtcatggccctgtccctgggtttaacaccagccct
gggctgattcaccctgccctccagggccttccaggcctccaaggccaccctggtctccaa
ggccaccaggagaaaaatggctttgtgggccgcattcacctcctgcctgacctgatccag
cagagccaccactccccctcctcctctgcctcctcctctccctcctcctccagcatggcg
agccccaccatgtccatgtccccccagagccccctggacaagctcagcatactcctggag
agtcattctgtcagcaacacaatgcagaaacacaagtcctcctcctccttcactcctttt
atcgatccacgcctcctccaggtctctacatccggcgccgctctcaacaacctggctttt
gggaacgatgccaggctggcggaggcactgagggcggacccgtcacgtaaaggctccgtg
gtcaatgtgaaccctgtcaacacacggccgcagagcgacaccccagagatccgcaagtac
aagaagaggttcaactctgagatcctgtgtgctgcgctctggggagtgaacctgctggtg
gggacagagagtggcctgatgctgctggatcgtagcggtcaggggaaggtgtatcccctc
atcagccgacgccgcttccaacaaatggatgtcctagagggactcaacgtcctggttact
atatcaggcaagaagaacaagttgcgtgtgtactatctgtcctggttgaggaacaagatc
ctgcacaacgaccctgaggtggagaagaagcagggctgggtcactgtgggagacctggag
ggtgctgttcactacaaagttgtgaaatacgagaggatcaagtttttggttttggccctg
aagaactcggtggaggtctatgcatgggcaccgaagccctaccacaagttcatggctttc
aagtcgtttggtgacctggtgcacaagcccctgctggttgacctgacggtggaggagggt
cagaggttaaaggtaatctatggctccagtaacggatttcatgccgtcgacgtggactcg
ggggcagtctacgacatctacctgcccacccatatccagaccagtatccagtcccatgcc
atcatcatcctgcccaacacagatggcattgagctgctggtgtgttacgaggacgagggt
gtctatgtcaacacctacggacgcatcaccaaggatgtggtgctgcagtggggcgagatg
cccacttctgtggcctatatccgttctaaccagataatggctnnggggggaaaagccata
gagatcagatctgtggagactggacatnctgacggagtcttcatgcacagaagagcccag
agactcaagttcctgtgtgagaggaacgacaaggtgttctttgcctcggtgcgatccgga
ggagccagccaggtgtactttatgaccctggggcgcacctctctgctcagctggtag

DBGET integrated database retrieval system