KEGG   Salvelinus alpinus (Arctic char): 111960621Help
Entry
111960621         CDS       T05762                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: NADPH--cytochrome P450 reductase-like
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
salp  Salvelinus alpinus (Arctic char)
Brite
KEGG Orthology (KO) [BR:salp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    111960621
Enzymes [BR:salp01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     111960621
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1 B NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 111960621
NCBI-ProteinID: XP_023838466
AA seq 676 aa AA seqDB search
MADVEAERSTQPEAMEEENPLFSNLDLFLFTLIAGLIVYWFMSRKKAEPIPEFKKLDQPA
PSTQETSFIEKMKKTGRNIVVFYGSQTGTGEEFANRLSKDAQRYGMKGMAADPEEYDMSE
LSRLAEIGNSLAIFCMATYGEGDPTDNXQDFYDWLQETDGELDGVNYTVFALGNKTYEHY
NAMGAYVDKRLEELGAKRVFDLGMGDDDGNLEEDFVTWREQFWPAMCEHFGVEASGEDSS
VRQYELREHNDINMNKVYTGELGRLKSFETQKPPFDAKNPFLAPVTVNRKLNKAGDRHLM
HLEVDITGSKIRYESGDHVAVYPTNDTAIVNRLGQILGVDLDSVISLNNLDEESNKKHPF
PCPTTYRTALTHYLDIIHPPRTNVLYELAQYATDPKDQENMRKMASSAPEGKALYQSFVL
EDNRNILAILEDLPSLRPPIDHLCELMPRLQARYYSIASSSKVHPNSIHICAVLVEYTTK
TGRLTKGVATTWLKNKLVADNGHKSTVPMYIRKSQFRLPFKASNPVIMVGPGTGIAPFMG
FIQERGWLKEQGKEVGETVLYCGCRHKKEDYLYQEELEEAEKTGVITKLNVAFSRDQEQK
VYVQHLLRTNKEDLWRQIHTDNAHIYICGDARNMARDVQTAFYEIAEELGGMTRSQATDY
IKKLMTKGRYSQDVWS
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgtggaagcagagcgcagcacccagccggaggccatggaggaggagaatcct
ctcttcagtaacctggacctcttcctcttcaccctcatcgccggcctcatcgtctactgg
ttcatgtcccgcaagaaggccgagcccatccccgagttcaagaagctcgaccaaccagca
ccttctactcaagagactagttttattgaaaagatgaagaaaacgggtaggaacatcgtg
gtattctacggctctcagacaggcacgggcgaggagtttgccaaccggctgtccaaagac
gcccagcgctacggcatgaagggtatggctgccgaccccgaggaatacgacatgtcggag
ctgtcccgtctggctgagattggcaactccctggccatcttctgcatggccacttacggt
gagggagaccccacagacaacncccaggacttctatgactggctgcaggagaccgacggg
gaattggatggagtcaactatactgtgtttgcgttgggcaacaagacatatgaacactac
aatgccatgggggcgtacgtggacaagaggctggaggaactgggagccaagagggtcttc
gacctgggcatgggagacgacgacggcaacctggaggaggactttgtgacatggagggag
cagttctggccagccatgtgtgagcactttggagtggaggcttcaggagaggactccagc
gttcgtcagtacgagctcagggagcacaatgacatcaacatgaacaaggtgtacacagga
gagttgggccgtctgaagagctttgagacccagaaacctccttttgatgcaaaaaatcca
ttcctggctccagtcactgttaaccgcaagctcaacaaagcaggcgacaggcatctcatg
caccttgaagtggacattacaggctccaagattagatatgagtcgggagaccacgttgcc
gtctatcctaccaatgacacagcgatcgtgaacaggctgggacagatccttggcgtggac
cttgattcagttatctctctcaacaaccttgatgaggagtccaataagaagcacccattc
ccttgccccaccacctaccgtacggctctgacccactacctggacatcatccacccgcct
cgcaccaatgtcctgtatgagctggcccagtacgccactgaccccaaggaccaggagaac
atgcgcaagatggcctcgtctgctcccgagggcaaggctctgtaccagagttttgtgctt
gaagacaacaggaacatcctcgccatcctggaggatctgccgtccttgcggcctcccatc
gaccacctgtgtgagctcatgccccgtttgcaggctcgctactactccattgcctcctcc
tccaaggtccaccccaatagcatccacatctgtgctgtgctggtggagtacacgactaaa
accgggcgcctcaccaagggagtggccaccacctggctgaagaacaaactggttgcggac
aacggccacaagtccacggtccccatgtacatccgcaagtcccagttccgcctgcccttc
aaggccagcaacccagtcatcatggtcggtcctgggaccggcatcgctcccttcatgggc
ttcatccaggagcgtgggtggctcaaagagcaaggcaaggaggtgggggagacggtcttg
tactgtggctgcaggcacaagaaagaggactatctgtaccaggaggagttggaggaggct
gagaagacgggtgtcatcacaaagctcaacgtggctttttctcgggaccaggagcaaaag
gtgtacgtgcagcatcttctgaggaccaacaaggaggacttgtggcggcagatccacaca
gacaacgcacacatatacatctgcggggatgcgcggaacatggccagggatgtgcagaca
gctttctatgagatagcagaggagctgggcggcatgacacgctctcaggccaccgactac
atcaagaaactgatgaccaagggacggtactcgcaggacgtctggagctaa

DBGET integrated database retrieval system