KEGG   Salvelinus alpinus (Arctic char): 111960632Help
Entry
111960632         CDS       T05762                                 

Definition
(RefSeq) protein IWS1 homolog isoform X1
  KO
K17498  transcription factor SPN1
Organism
salp  Salvelinus alpinus (Arctic char)
Brite
KEGG Orthology (KO) [BR:salp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:salp03021]
    111960632
Transcription machinery [BR:salp03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     111960632
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med26
Motif
Other DBs
NCBI-GeneID: 111960632
NCBI-ProteinID: XP_023838488
AA seq 756 aa AA seqDB search
MDGEEDEFFSGNHSDGGGTPVQDENAPGSDAEEERKESCHSEDENSHGEGAAQAMETNGL
ASGSDNEGHKREDSDSEEEEPVKRGTSDVECTPPPKRRGSNSDVECTPPPKRRGSNSDVE
CTPPPKRRGSNSDVECTSPPKRRGSNSDIEGPQVKHRGCTSDMEEKETKQAAAGSDSENE
DQPPSPARSRHSNARSDSETEVPEHKAQIESDGKEEECGEKKGKWKAVMHSDSEDEVEAR
SVKAAAGSGQEKDSPAKQVVDDSEDDDAMPMKRKKAILSDSEDEEEKADEPASKKSRTVS
DDENSDSNAGSEAPDKTMAKLRELGSESEDEDDGQKAAGGKKDEKTLFGSDSESGDEEEK
MIADIFGDSGDEEGEEFTGFNQEDLEGDKNQSQASAKKAMADDSDSDEGVDRGGGQDTSF
MSDFDVMLARKKAQSGKRRRNRDGGTFISDADDVVSAMIAKMTEAAEEDRTLNAQKKPAL
KKLTLLPTVVMHLKKQDLKETFIDSGVMSAIKEWIGPLPDKSLPALKIRADLLKILQELP
SVSQETLKHSGIGRAVMFLYKHPKESRPNKDLALKLINEWSRPIFGLTSNYKGMTREERQ
QRDLDQQMPPKRLLSQPQKVDRSKEPDVFSPQQLRFSVVAWLLRLPSDFGCSLIFNLSSS
GGQTPHRDLEKVLTGEEKALRPGDPGFCARARVPMPSNKDYVVRPKWNVESESRAAPVKK
GVSRVDKQLRRFADIKRMTKTGHAVKISVQGNRMPL
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atggatggcgaagaggacgaattcttctccgggaaccactctgatggtggtggcaccccg
gtacaggacgaaaatgctcccggttcagatgcggaagaggagaggaaggagtcgtgccac
tcagaggatgagaatagtcatggtgagggagcagctcaggccatggagacaaacggtttg
gccagtgggtcagacaacgagggccacaaaagggaggacagtgactctgaggaggaggaa
ccagtcaaacgcggcacctcagacgtagagtgcacccccccacccaaacgcagaggcagc
aactcagacgtagagtgcacccccccacccaaacgcagaggcagcaactcagacgtagag
tgcacccccccacccaaacgcagaggcagcaactcagacgtagagtgcacctccccaccc
aaacgcagaggcagcaactcggacattgagggtccccaagtcaaacacagaggctgcacc
tctgacatggaggagaaagaaaccaagcaggctgcagccgggagcgactctgagaacgag
gatcagcccccgtctccagcccggagcagacactcgaatgcacgcagtgattctgagacg
gaggtgcccgaacacaaagcacagatcgagtctgatggaaaggaggaggagtgcggtgag
aagaaggggaagtggaaggctgtaatgcattctgacagtgaggatgaggtggaggctcgg
tcagtgaaagcagctgcaggcagtggccaggagaaggatagtcccgcaaaacaggtggtg
gacgatagtgaggatgacgacgcaatgccaatgaagaggaagaaagccatcctgtcagac
agtgaagatgaggaggagaaggctgacgaaccagcgtcgaagaagagccgcaccgtgtct
gacgacgagaactctgacagtaacgcaggctcagaagcgcccgacaaaaccatggccaaa
ctgcgggagctgggctcagaaagcgaagacgaggatgatggacagaaggcggcaggaggg
aagaaggacgagaaaacactgtttggtagcgacagcgaatcaggtgacgaagaagagaaa
atgattgcagacatttttggtgactcaggtgatgaagagggggaagagtttacgggtttc
aatcaggaggatctggagggggataagaaccaatcacaggcctcggcaaagaaagcaatg
gcagacgactcggactctgacgagggcgtggacaggggtggtggccaagacaccagcttc
atgtcagactttgacgtgatgctggctcgtaagaaggcccagagcgggaagcggcgacgg
aaccgcgacgggggaacgttcataagtgacgctgacgacgtggtcagcgccatgatcgcc
aagatgacagaggctgcagaggaggacagaacactgaacgctcagaagaagccagcctta
aagaagctgaccctcctccccactgtagttatgcacctgaaaaagcaagacctcaaggag
acgttcatcgacagtggagtgatgtcggccatcaaggagtggatcggccccctgccagac
aagagtctcccggccctcaaaatcagagcggatctcctcaagatcctacaggaactcccc
agtgtgagtcaggagactcttaaacacagcgggattggccgagccgtcatgttcctctac
aaacaccccaaggagtcgcgccccaacaaggacctcgccctcaaactcatcaacgagtgg
tcccgccccatctttggcctgacatccaactacaagggcatgacgcgcgaggagagacaa
cagagagaccttgaccagcaaatgccacctaaaagactcctcagtcagccccaaaaggtg
gataggtccaaggaaccggatgtcttctccccgcagcaactcaggttcagtgtggttgca
tggttgctccgcctcccgagtgactttggctgcagtctgattttcaacctctccagctca
gggggacagactcctcatagagacctggaaaaagtactgacaggagaagagaaagctctg
cgcccaggtgaccctgggttctgtgcccgagccagggtgcccatgccatccaacaaggac
tacgttgtgcggcccaaatggaacgtggagagcgagtccagagcagcccccgttaagaag
ggcgtgtcacgggtggacaaacagttgcgtcgctttgccgacatcaagcgtatgacgaag
acaggccacgcggtgaaaatcagcgtccagggcaaccggatgcccctctga

DBGET integrated database retrieval system